Loading...
Resultater for: Sko, tilbehør
Fant 581 selskaperRelaterte kategorier
supplyautonomy.com/xiamenshuangfaimpexpco.cn
Huian Fasheng Stone Co.,Ltd specializes in European Tombstones, monument, headstone and trading products. Which was located in NO.506 Longxi Industrial Zone, Chongwu Town, Quanzhou City. Factory... Les mer »
- Steintrapper | Servanter | Shoe horn | Sanitærutstyr
- Xiamen
- Kina
supplyautonomy.com/artexthuanhung.vn
wooden shoehorn call for the use of second easily.Shoe horn is made from 100% natural wood, and completely handmade.
Thus our products have stable characteristic with similar product lines to more... Les mer »
- Shoe horn | Tresko | Fottøy | Kleshengere
- Ha Noi
- Vietnam
supplyautonomy.com/ozdenkimyaveplastiksanayiticaretsti.tr
Our company Ozden Group is a Turkish leading professional manufacturer and exporter of shoe and leather care products under the brand name of SMART and VILO, located in Ankara. Also our company is... Les mer »
- Rengjøringsutstyr | Sko deodorant | Plast - emballasje | Maling og lakk | Vaskemidler
- Ankara
- Tyrkia
supplyautonomy.com/shoesmanufacturerchina1.cn
Shoes Manufacturer China
Address: HAOJIASHIQIAO 23, HUANGDAO DISTRICT, QINGDAO, CHINA
Phone: +86 13854238922
Email: [email protected]
Website: https://www.qd-bestrade.com/
There... Les mer »
- Sko behandling tjenester | Sko design tjenester | Idretts- og fritidssko | Sko og tilbehør | Sko, produsenter
- HUANGDAO DISTRICT
- Kina
supplyautonomy.com/uabatshoes.gb
The online cheap shoes Uabat website sells two versions of self-made replica shoes, one is top quality Uabat shoes and the other is high quality Og shoes.In short, the quality of UABAT is the... Les mer »
- Sports fottøy | Sko, turnsko | Menns sportssko | Sko lager | Sko og tilbehør
- London
- Storbritannia
supplyautonomy.com/smcpasialimited.hk
Known for its clean lines and sophisticated aesthetic, Sandro is a leading accessible luxury Parisian brand featuring refined and versatile men’s and women’s collections. Evelyne Chetrite, founder and... Les mer »
- Menns antrekk | Kvinners klær | Sko og tilbehør
- Hong Kong
- Hongkong
supplyautonomy.com/eagletrade.us
supplyautonomy.com/stylensteelincpvt.in
Style N Steel Inc. ( An ISO 9001:2008 Company) , BSCI Audited , Sedex , Social Ethical Compliance Factory
Style N Steel Inc. was born with clear intention of carving its niche in International... Les mer »
- Shoe horn | Kurvfletting | Bedrifter og salgsfremmende gaver
- Delhi
- India
supplyautonomy.com/colliniatomidiscarpasrl.it
supplyautonomy.com/xiamejoyforceelectronicsco.cn
Established in 2003, Xiamen Joyforce Electronics Co., Ltd. (Joyforce) is a professional manufacturer and exporter of healthcare massagers in China. Our company attained ISO9001 Quality System... Les mer »
- Shoe pensel | Massasje - apparater og instrumenter | Skjønnhetspleie - instrumenter
- Xiamen
- Kina
supplyautonomy.com/tanishqworld.in
Established in 1998 , TANISHQ WORLD is a reputed company in India, have craved a niche amongst manufacturers and exporters with their signature range of executive Scarves, Stoles, Shawls, Pareos,... Les mer »
- Asia og Stillehavet øyer klær | Etniske plagg | Shoe etiketter og koder
- New Delhi
- India
supplyautonomy.com/westinghouseusajetindia.in
Rich domain expertise combined with tremendous excellence in product innovation is the driving force of A-1 Jet India. Incepted in the year 1993, we are counted among the major global providers of... Les mer »
- Luftrensere | Shoe polering utstyr | Gardiner
- Mumbai
- India
supplyautonomy.com/qingdaojoyeehousewaresco.cn
JOYEE Housewares Co., Ltd. is a professional manufacturer and exporter specialized in producing various aromatic red cedar accessores as well as hardwood shoe care articles. With years' of... Les mer »
- Skopleie kit
- Qingdao
- Kina
supplyautonomy.com/allwinbrushes.in
India's One of the biggest manufacturers of brushes, Mops, Wipers, brooms, cotton mops etc.
Cleaning brushes of all types made by CNC machines from Belgium and Germany with very high output... Les mer »
- Shoe pensel | Vaskemidler | Ståltråd, piggtråd
- Agra
- India
supplyautonomy.com/beijingsierzutuotechnologyco.cn
Beijing Sierzutuo Technology Co., Ltd. is a professional manufacturer of GEL insoles in China, which is specialized in study, production and sales of all kinds of foot care products with different... Les mer »
- Innleggssåler
- Beijing
- Kina
supplyautonomy.com/jitaifujiansportsgoodsco.cn
JiTai (FuJian) Sports Goods Co., Ltd. owns abundant technologies, complete management systems, wide sales network, and perfect post-sale services. Stressing the prestige and providing our customers... Les mer »
- Innleggssåler
- Zhangzhou
- Kina
supplyautonomy.com/shenzhensaiengelproductco.cn
Established in 2007, our factory is a professional manufacturer engaged in producing PU gel and PU foam products. Our main products include the gel insoles, gel sticky pads, gel mats, gel pillows... Les mer »
- Innleggssåler
- Shenzhen
- Kina
supplyautonomy.com/yangzhoukingstonetoysco.cn
Yangzhou Kingstone Toys Co., Ltd. is sub-company of Yangzhou Kingdom Arts and Crafts Co., Ltd., located in the ancient city - Yangzhou, which is famous for stuffed toys, caps and shoes.
We are a... Les mer »
- Skolissene
- Yangzhou
- Kina
supplyautonomy.com/xiamencenxingimportexportco.cn
Xiamen Cenxing Import Export Co., Ltd. is a leading pet products manufacturer. We mainly focus on pets toys, pets furniture, pets houses, pets beds, pet apparel, cats trees and related pets... Les mer »
- Skolissene
- Xiamen
- Kina
supplyautonomy.com/guangzhoujinyeshangdianfashionaccessoriesco.cn
Guangzhou Jinye Shangdian Fashion Accessories Co.,Ltd are mainly engaged in promotion gift, mobile phone accessory,fashion accessory,fashion jewelry and handcraft gift.
Excellent handmade craft... Les mer »
- Skolissene
- Guangzhou
- Kina
supplyautonomy.com/yangjiangxinchengindustrytradeco.cn
Yangjiang Xingcheng Industry and trade Co., Ltd. is a premium enterprise manufacturing and exporting kitchenware. Our products are Kitchen gadgets, Knives Scissors, BBQ tools, Cake Modes and other... Les mer »
- Shoe horn
- Yangjiang
- Kina
supplyautonomy.com/quanzhouzhenghannonwoventechnologyco.cn
Quanzhou Zhenghan Nonwoven Technology CO.,LTD., a HONG KONG-owned Enterprise established in the year of 2002. The company is a technical enterprise focusing on non woven fabric, with a variety of... Les mer »
- Innleggssåler
- Jinjiang
- Kina
supplyautonomy.com/lixianmeiyuancosmeticlimitedcorporation.cn
Founded in 2001, Lixian Meiyuan Cosmetic Limited Corporation is a private enterprise located in the south of Baoding City, Hebei Province. We are close to Beijing and Tianjin, and we have a big... Les mer »
- Skopleie kit
- Baoding City
- Kina
supplyautonomy.com/yifengindustrialtradingco.cn
Our marketing tenet is "stable quality and being professional in integrative cooperation all the time".
Established August 2000, we are located in ''The Knife Scissors... Les mer »
- Skopleie kit
- Yangjiang
- Kina
supplyautonomy.com/sunsumhouseholdco.cn
Sunsum Household Co., Ltd. is a professional plastic household product manufacturer in China. Our products have been exported to many countries and regions around the world, such as Germany, France,... Les mer »
- Innleggssåler
- Ningbo
- Kina
supplyautonomy.com/wujiangcitylidalustrefinishedproductsco.cn
We are a leading shoe polishing product manufacturer in China.
Our products are tin shoe polish, liquid polish, cream polish, self shine sponge, and aerosol shoe care.
We are the factory engaged... Les mer »
- Innleggssåler
- Wujiang
- Kina
supplyautonomy.com/zhongshanemartnonwovenshoesmaterialsco.cn
Zhongshan E-Mart Non-Wovenshoes Materials Co., Ltd. specializes in producing non-woven materials, normal non-woven insoles, Strobel PP antistatic insoles, Strobel materials, imitation leather,... Les mer »
- Innleggssåler
- Zhongshan
- Kina
supplyautonomy.com/foshancitylinzhishoesmaterialcolzinsole.cn
Foshan Linzhi Shoes Material Co., Ltd. located in Foshan, Guangdong, is specialized in manufacturing Shoe Materials.
LZ INSOLE With an experienced and professional team, With our own... Les mer »
- Innleggssåler
- Foshan
- Kina
supplyautonomy.com/shenzhenpowerpluselectronicsco.cn
Power Plus founded in 1998 AD, from a 10 staffs to over 4,000 employee, based on our principal: look quality as
our life. amoong the 4,000, there are 1500 QC staffs and 120 RD staffs engaged to... Les mer »
- Innleggssåler
- Shenzhen
- Kina
supplyautonomy.com/dongguanhoujiehuntshoesmaterialfactory.cn
Dongguan Houjie Hunt Shoes Material Factory was started from 2004, specializing in providing memory foam pillows, mouse pads and insoles. They are all eco-friendly, healthy and comfortable products.... Les mer »
- Innleggssåler
- Dongguan City
- Kina