জন্য অনুসন্ধান ফলাফল: মুদ্রন এবং গ্রাফিক্স সরঞ্জাম
পাওয়া 277 কোম্পানিসম্পর্কিত পছন্দের তালিকা: মুদ্রন এবং গ্রাফিক্স সরঞ্জাম
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... আরো পড়ুন »
- ব্যাগ তৈরীর যন্ত্রপাতি | মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | কাগজ শ্রেণীবিভাজন যন্ত্রপাতি ও সরঞ্জাম | ডিম্বপ্রসর মেশিন (laybo...
- Hyderabad
- ভারত
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... আরো পড়ুন »
- নিরাপত্তা পণ্য এজেন্ট | স্থানান্তর প্রিন্টিং | ইনজেকশন ছাঁচনির্মাণ পরিষেবা, ধাতু | নিরোধক উপকরণ | কাস্টম নকশা স্প্রিংস |...
- Amravati
- ভারত
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... আরো পড়ুন »
- নিরাপত্তা পণ্য এজেন্ট | স্থানান্তর প্রিন্টিং | ইনজেকশন ছাঁচনির্মাণ পরিষেবা, ধাতু | নিরোধক উপকরণ | কাস্টম নকশা স্প্রিংস |...
- Mumbai
- ভারত
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... আরো পড়ুন »
- নিরাপত্তা পণ্য এজেন্ট | স্থানান্তর প্রিন্টিং | ইনজেকশন ছাঁচনির্মাণ পরিষেবা, ধাতু | নিরোধক উপকরণ | কাস্টম নকশা স্প্রিংস |...
- Faridabad
- ভারত
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... আরো পড়ুন »
- অন্য পোশাক যন্ত্রপাতি | মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | পিচবোর্ড তৈরীর মেশিন, একটানা, সিলিন্ডার | Moulds, সিলিন্ডার, পি...
- Mumbai
- ভারত
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... আরো পড়ুন »
- নিরাপত্তা পণ্য এজেন্ট | স্থানান্তর প্রিন্টিং | ইনজেকশন ছাঁচনির্মাণ পরিষেবা, ধাতু | নিরোধক উপকরণ | কাস্টম নকশা স্প্রিংস |...
- Bardoli
- ভারত
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... আরো পড়ুন »
- নিরাপত্তা পণ্য এজেন্ট | স্থানান্তর প্রিন্টিং | ইনজেকশন ছাঁচনির্মাণ পরিষেবা, ধাতু | নিরোধক উপকরণ | কাস্টম নকশা স্প্রিংস |...
- Ahmedabad
- ভারত
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... আরো পড়ুন »
- নিরাপত্তা পণ্য এজেন্ট | স্থানান্তর প্রিন্টিং | ইনজেকশন ছাঁচনির্মাণ পরিষেবা, ধাতু | নিরোধক উপকরণ | কাস্টম নকশা স্প্রিংস |...
- Pune
- ভারত
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... আরো পড়ুন »
- নিরাপত্তা পণ্য এজেন্ট | স্থানান্তর প্রিন্টিং | ইনজেকশন ছাঁচনির্মাণ পরিষেবা, ধাতু | নিরোধক উপকরণ | কাস্টম নকশা স্প্রিংস |...
- Kalol
- ভারত
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | ছাপাখানা, সিলিন্ডার, সিঙ্গল বিপ্লব | ছাপাখানা, সিলিন্ডার, দুই বিপ্লব | ছাপাখানা, সিলিন্ডা...
- Wadhwan
- ভারত
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... আরো পড়ুন »
- ব্যাগ | ভিজা steaming মেশিন, টেক্সটাইল | শুকনো steaming মেশিন, টেক্সটাইল | Steaming যন্ত্রপাতি, কম চাপ, টেক্সটাইল | Stea...
- New Delhi
- ভারত
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... আরো পড়ুন »
- নিরাপত্তা পণ্য এজেন্ট | স্থানান্তর প্রিন্টিং | ইনজেকশন ছাঁচনির্মাণ পরিষেবা, ধাতু | নিরোধক উপকরণ | কাস্টম নকশা স্প্রিংস |...
- Ilkal
- ভারত
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- আমদানীকারক-রপ্তানীকারকদের, কাগজ | টয়লেট পেপার | রুমাল, handkerchiefs এবং মুখের টিস্যু, সেলুলোজ wadding | টয়লেট পেপার, ...
- Jodhpur
- ভারত
supplyautonomy.com/laxmiudyog.in
- নিরাপত্তা পণ্য এজেন্ট | স্থানান্তর প্রিন্টিং | ইনজেকশন ছাঁচনির্মাণ পরিষেবা, ধাতু | নিরোধক উপকরণ | কাস্টম নকশা স্প্রিংস |...
- Mumbai
- ভারত
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... আরো পড়ুন »
- সংযোগ | বল ভালভ | প্রজাপতি ভালভ | কনভেয়র বেল্ট, ফাইবার সিমেন্ট | ফাইবার সিমেন্ট পণ্য, অগ্নি প্রতিরোধক | মুদ্রন এবং গ্র...
- Howrah
- ভারত
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... আরো পড়ুন »
- মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | পেপার প্রসেসিং যন্ত্রাদি | প্রিন্টার ও binders...
- Ahmedabad
- ভারত
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... আরো পড়ুন »
- প্রসারিত ফিল্ম | মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | প্যাকেজিং যন্ত্রপাতি...
- Wenzhou
- চীন
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... আরো পড়ুন »
- মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | পেপার প্রসেসিং যন্ত্রাদি | MILLING ধাতু জন্য মেশিন টুলস...
- Cangzhou
- চীন
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... আরো পড়ুন »
- মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | লেজার সরঞ্জাম
- Shenzhen
- চীন
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... আরো পড়ুন »
- যন্ত্রপাতি পরিষ্কারের | মুদ্রন এবং গ্রাফিক্স সরঞ্জাম...
- Taixing
- চীন
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... আরো পড়ুন »
- মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | অন্য উপাদান হ্যান্ডলিং যন্ত্রপাতি...
- Wenzhou
- চীন
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... আরো পড়ুন »
- ব্যাগ তৈরীর যন্ত্রপাতি | মুদ্রন এবং গ্রাফিক্স সরঞ্জাম...
- Ruian
- চীন
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... আরো পড়ুন »
- ব্যাগ তৈরীর যন্ত্রপাতি | মুদ্রন এবং গ্রাফিক্স সরঞ্জাম...
- Ruian
- চীন
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... আরো পড়ুন »
- ব্যাগ তৈরীর যন্ত্রপাতি | মুদ্রন এবং গ্রাফিক্স সরঞ্জাম...
- Ruian
- চীন
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... আরো পড়ুন »
- মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | কাগজ পণ্য তৈরীর যন্ত্রপাতি...
- Dongguan
- চীন
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... আরো পড়ুন »
- বস্তা ও ব্যাগ | সেলাই মেশিন | মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | প্যাকেজিং যন্ত্রপাতি...
- Wenzhou
- চীন
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... আরো পড়ুন »
- অন্য টেক্সটাইল যন্ত্রপাতি | মুদ্রন এবং গ্রাফিক্স সরঞ্জাম...
- Ahmedabad
- ভারত
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... আরো পড়ুন »
- ব্যাগ তৈরীর যন্ত্রপাতি | মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | প্যাকেজিং যন্ত্রপাতি...
- Vadodara
- ভারত
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... আরো পড়ুন »
- টেক্সটাইল-FINISHING যন্ত্রপাতি | মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | প্যাকেজিং যন্ত্রপাতি...
- Ahmedabad
- ভারত
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... আরো পড়ুন »
- মুদ্রন এবং গ্রাফিক্স সরঞ্জাম | সিমেন্ট ব্যাগ | তড়িৎ এবং ইলেকট্রনিক যন্ত্রপাতি...
- Ahmedabad
- ভারত