కోసం శోధన ఫలితాలు: షూస్, ఉపకరణాలు
దొరకలేదు 580 కంపెనీలుసంబంధిత వర్గాలు
supplyautonomy.com/babyfootwears.au
supplyautonomy.com/ozdenkimyaveplastiksanayiticaretsti.tr
Our company Ozden Group is a Turkish leading professional manufacturer and exporter of shoe and leather care products under the brand name of SMART and VILO, located in Ankara. Also our company is... మరింత చదవండి »
- పరికరాలు క్లీనింగ్ | షూ దుర్గంధనాశని | ప్లాస్టిక్స్ - ప్యాకేజింగ్ | రంగులు మరియు చెక్క వస్తువులపై వేసే రంగులు | ఉత్పత్త...
- Ankara
- టర్కీ
supplyautonomy.com/shoesmanufacturerchina1.cn
Shoes Manufacturer China
Address: HAOJIASHIQIAO 23, HUANGDAO DISTRICT, QINGDAO, CHINA
Phone: +86 13854238922
Email: [email protected]
Website: https://www.qd-bestrade.com/
There... మరింత చదవండి »
- షూస్ ప్రాసెసింగ్ సేవలు | షూస్ డిజైన్ సేవలు | షూస్, క్రీడలు మరియు విశ్రాంతి | షూస్ మరియు ఉపకరణాలు | షూస్, తయారీదారులు...
- HUANGDAO DISTRICT
- చైనా
supplyautonomy.com/uabatshoes.gb
The online cheap shoes Uabat website sells two versions of self-made replica shoes, one is top quality Uabat shoes and the other is high quality Og shoes.In short, the quality of UABAT is the... మరింత చదవండి »
- క్రీడా పాదరక్షలతో | Plimsolls | పురుషుల క్రీడా షూలు | షూస్ స్టాక్ | షూస్ మరియు ఉపకరణాలు...
- London
- బ్రిటన్
supplyautonomy.com/smcpasialimited.hk
Known for its clean lines and sophisticated aesthetic, Sandro is a leading accessible luxury Parisian brand featuring refined and versatile men’s and women’s collections. Evelyne Chetrite, founder and... మరింత చదవండి »
- పురుషుల అలంకరించు | మహిళల దుస్తుల | షూస్ మరియు ఉపకరణాలు...
- Hong Kong
- హాంగ్ కాంగ్
supplyautonomy.com/eagletrade.us
supplyautonomy.com/colliniatomidiscarpasrl.it
Collini Atomi di Scarpa S. R. L. Has been an Italian leading supplier of footwear accessories, shoes accessories, leather goods accessories, clothing accessories and jewellery since 1943.
We can... మరింత చదవండి »
- షూ చెట్లు | లెదర్ మరియు బూట్లు - సరఫరా మరియు ఉపకరణాలు...
- Noventa Padovana
- ఇటలి
supplyautonomy.com/xiamejoyforceelectronicsco.cn
Established in 2003, Xiamen Joyforce Electronics Co., Ltd. (Joyforce) is a professional manufacturer and exporter of healthcare massagers in China. Our company attained ISO9001 Quality System... మరింత చదవండి »
- షూ బ్రష్ | మసాజ్ సాధన | అందం సంరక్షణ - సాధన
- Xiamen
- చైనా
supplyautonomy.com/tanishqworld.in
Established in 1998 , TANISHQ WORLD is a reputed company in India, have craved a niche amongst manufacturers and exporters with their signature range of executive Scarves, Stoles, Shawls, Pareos,... మరింత చదవండి »
- ఆసియా మరియు పసిఫిక్ ద్వీపాల దుస్తులు | భారతీయ దుస్తులు | షూ లేబుల్స్ మరియు టాగ్లు...
- New Delhi
- భారత దేశం
supplyautonomy.com/westinghouseusajetindia.in
Rich domain expertise combined with tremendous excellence in product innovation is the driving force of A-1 Jet India. Incepted in the year 1993, we are counted among the major global providers of... మరింత చదవండి »
- ఎయిర్ శుభ్రపరిచే | షూ సానపెట్టే పరికరాలు | కర్టన్లు...
- Mumbai
- భారత దేశం
supplyautonomy.com/stylensteelincpvt.in
Style N Steel Inc. ( An ISO 9001:2008 Company) , BSCI Audited , Sedex , Social Ethical Compliance Factory
Style N Steel Inc. was born with clear intention of carving its niche in International... మరింత చదవండి »
- షూ కొమ్ములు | Basketry | ప్రచార & కార్పొరేట్ బహుమతులు...
- Delhi
- భారత దేశం
supplyautonomy.com/yifengindustrialtradingco.cn
Our marketing tenet is "stable quality and being professional in integrative cooperation all the time".
Established August 2000, we are located in ''The Knife Scissors... మరింత చదవండి »
- షూ సంరక్షణ కిట్
- Yangjiang
- చైనా
supplyautonomy.com/yangzhoukingstonetoysco.cn
Yangzhou Kingstone Toys Co., Ltd. is sub-company of Yangzhou Kingdom Arts and Crafts Co., Ltd., located in the ancient city - Yangzhou, which is famous for stuffed toys, caps and shoes.
We are a... మరింత చదవండి »
- Shoelaces
- Yangzhou
- చైనా
supplyautonomy.com/xiamencenxingimportexportco.cn
Xiamen Cenxing Import Export Co., Ltd. is a leading pet products manufacturer. We mainly focus on pets toys, pets furniture, pets houses, pets beds, pet apparel, cats trees and related pets... మరింత చదవండి »
- Shoelaces
- Xiamen
- చైనా
supplyautonomy.com/guangzhoujinyeshangdianfashionaccessoriesco.cn
Guangzhou Jinye Shangdian Fashion Accessories Co.,Ltd are mainly engaged in promotion gift, mobile phone accessory,fashion accessory,fashion jewelry and handcraft gift.
Excellent handmade craft... మరింత చదవండి »
- Shoelaces
- Guangzhou
- చైనా
supplyautonomy.com/yangjiangxinchengindustrytradeco.cn
Yangjiang Xingcheng Industry and trade Co., Ltd. is a premium enterprise manufacturing and exporting kitchenware. Our products are Kitchen gadgets, Knives Scissors, BBQ tools, Cake Modes and other... మరింత చదవండి »
- షూ కొమ్ములు
- Yangjiang
- చైనా
supplyautonomy.com/qingdaojoyeehousewaresco.cn
JOYEE Housewares Co., Ltd. is a professional manufacturer and exporter specialized in producing various aromatic red cedar accessores as well as hardwood shoe care articles. With years' of... మరింత చదవండి »
- షూ సంరక్షణ కిట్
- Qingdao
- చైనా
supplyautonomy.com/lixianmeiyuancosmeticlimitedcorporation.cn
Founded in 2001, Lixian Meiyuan Cosmetic Limited Corporation is a private enterprise located in the south of Baoding City, Hebei Province. We are close to Beijing and Tianjin, and we have a big... మరింత చదవండి »
- షూ సంరక్షణ కిట్
- Baoding City
- చైనా
supplyautonomy.com/allwinbrushes.in
India's One of the biggest manufacturers of brushes, Mops, Wipers, brooms, cotton mops etc.
Cleaning brushes of all types made by CNC machines from Belgium and Germany with very high output... మరింత చదవండి »
- షూ బ్రష్ | ఉత్పత్తులు క్లీనింగ్ | స్టీల్ తీగ, ముళ్ల...
- Agra
- భారత దేశం
supplyautonomy.com/sunsumhouseholdco.cn
Sunsum Household Co., Ltd. is a professional plastic household product manufacturer in China. Our products have been exported to many countries and regions around the world, such as Germany, France,... మరింత చదవండి »
- Insoles
- Ningbo
- చైనా
supplyautonomy.com/wujiangcitylidalustrefinishedproductsco.cn
We are a leading shoe polishing product manufacturer in China.
Our products are tin shoe polish, liquid polish, cream polish, self shine sponge, and aerosol shoe care.
We are the factory engaged... మరింత చదవండి »
- Insoles
- Wujiang
- చైనా
supplyautonomy.com/zhongshanemartnonwovenshoesmaterialsco.cn
Zhongshan E-Mart Non-Wovenshoes Materials Co., Ltd. specializes in producing non-woven materials, normal non-woven insoles, Strobel PP antistatic insoles, Strobel materials, imitation leather,... మరింత చదవండి »
- Insoles
- Zhongshan
- చైనా
supplyautonomy.com/foshancitylinzhishoesmaterialcolzinsole.cn
Foshan Linzhi Shoes Material Co., Ltd. located in Foshan, Guangdong, is specialized in manufacturing Shoe Materials.
LZ INSOLE With an experienced and professional team, With our own... మరింత చదవండి »
- Insoles
- Foshan
- చైనా
supplyautonomy.com/shenzhenpowerpluselectronicsco.cn
Power Plus founded in 1998 AD, from a 10 staffs to over 4,000 employee, based on our principal: look quality as
our life. amoong the 4,000, there are 1500 QC staffs and 120 RD staffs engaged to... మరింత చదవండి »
- Insoles
- Shenzhen
- చైనా
supplyautonomy.com/dongguanhoujiehuntshoesmaterialfactory.cn
Dongguan Houjie Hunt Shoes Material Factory was started from 2004, specializing in providing memory foam pillows, mouse pads and insoles. They are all eco-friendly, healthy and comfortable products.... మరింత చదవండి »
- Insoles
- Dongguan City
- చైనా
supplyautonomy.com/quanzhouzhenghannonwoventechnologyco.cn
Quanzhou Zhenghan Nonwoven Technology CO.,LTD., a HONG KONG-owned Enterprise established in the year of 2002. The company is a technical enterprise focusing on non woven fabric, with a variety of... మరింత చదవండి »
- Insoles
- Jinjiang
- చైనా
supplyautonomy.com/shenzhensaiengelproductco.cn
Established in 2007, our factory is a professional manufacturer engaged in producing PU gel and PU foam products. Our main products include the gel insoles, gel sticky pads, gel mats, gel pillows... మరింత చదవండి »
- Insoles
- Shenzhen
- చైనా
supplyautonomy.com/jitaifujiansportsgoodsco.cn
JiTai (FuJian) Sports Goods Co., Ltd. owns abundant technologies, complete management systems, wide sales network, and perfect post-sale services. Stressing the prestige and providing our customers... మరింత చదవండి »
- Insoles
- Zhangzhou
- చైనా
supplyautonomy.com/beijingsierzutuotechnologyco.cn
Beijing Sierzutuo Technology Co., Ltd. is a professional manufacturer of GEL insoles in China, which is specialized in study, production and sales of all kinds of foot care products with different... మరింత చదవండి »
- Insoles
- Beijing
- చైనా
supplyautonomy.com/dongguanxinhuayefibertechnologyco.cn
Dongguan Xinhuaye Fiber Technology Co., Ltd. is a private enterprise specializing in the production of insole boards and shankboard. Our company is located in Zhongtang Town of Dongguan City.... మరింత చదవండి »
- Insoles
- Dongguan
- చైనా