Loading...
Sökresultat för: Tryckeriutrustning och grafisk utrustning
Funna 277 företagPrioriterade listor relaterade till: Tryckeriutrustning och grafisk utrustning
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Läs mer »
- Bag gör maskiner | Tryckeriutrustning och grafisk utrustning | Maskiner och utrustning för papperssortering | A...
- Hyderabad
- Indien
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Läs mer »
- Säkerhet produkt agenter | Transfer Tryck | Formsprutning, metall | Isoleringsmaterial | Fjädrar enligt ritning | Fasta ...
- Amravati
- Indien
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Läs mer »
- Säkerhet produkt agenter | Transfer Tryck | Formsprutning, metall | Isoleringsmaterial | Fjädrar enligt ritning | Fasta ...
- Mumbai
- Indien
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Läs mer »
- Säkerhet produkt agenter | Transfer Tryck | Formsprutning, metall | Isoleringsmaterial | Fjädrar enligt ritning | Fasta ...
- Faridabad
- Indien
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Läs mer »
- Övriga kläder maskiner | Tryckeriutrustning och grafisk utrustning | Kontinuerliga rundviramaskiner för ka...
- Mumbai
- Indien
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Läs mer »
- Säkerhet produkt agenter | Transfer Tryck | Formsprutning, metall | Isoleringsmaterial | Fjädrar enligt ritning | Fasta ...
- Bardoli
- Indien
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Läs mer »
- Säkerhet produkt agenter | Transfer Tryck | Formsprutning, metall | Isoleringsmaterial | Fjädrar enligt ritning | Fasta ...
- Ahmedabad
- Indien
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Läs mer »
- Säkerhet produkt agenter | Transfer Tryck | Formsprutning, metall | Isoleringsmaterial | Fjädrar enligt ritning | Fasta ...
- Pune
- Indien
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Läs mer »
- Säkerhet produkt agenter | Transfer Tryck | Formsprutning, metall | Isoleringsmaterial | Fjädrar enligt ritning | Fasta ...
- Kalol
- Indien
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Tryckeriutrustning och grafisk utrustning | Tryckpressar, cylinder pressar, Envarvig | Tryckpressar, cylinder pressar,...
- Wadhwan
- Indien
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Läs mer »
- Väskor | Våtdekatermaskiner för textilindustrin | Torrdekatermaskiner för textilindustrin | Ångningsapparater med lågt t...
- New Delhi
- Indien
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Läs mer »
- Säkerhet produkt agenter | Transfer Tryck | Formsprutning, metall | Isoleringsmaterial | Fjädrar enligt ritning | Fasta ...
- Ilkal
- Indien
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Importörer och exportörer av papper | Toalettpapper | Servetter, näsdukar och ansiktsservetter av cellulosavadd | Vått t...
- Jodhpur
- Indien
supplyautonomy.com/laxmiudyog.in
- Säkerhet produkt agenter | Transfer Tryck | Formsprutning, metall | Isoleringsmaterial | Fjädrar enligt ritning | Fasta ...
- Mumbai
- Indien
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Läs mer »
- Fasta kopplingar | Kulventiler | Vridspjällventiler | Transportband av fibercement | Eldbeständiga fibercementprodukter ...
- Howrah
- Indien
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Läs mer »
- Tryckeriutrustning och grafisk utrustning | Papper maskiner | Skrivare och bindemedel
- Ahmedabad
- Indien
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Läs mer »
- Sträckfilm | Tryckeriutrustning och grafisk utrustning | Förpackningsmaskiner
- Wenzhou
- Kina
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Läs mer »
- Tryckeriutrustning och grafisk utrustning | Papper maskiner | Maskinverktyg för metallfräsning
- Cangzhou
- Kina
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Läs mer »
- Tryckeriutrustning och grafisk utrustning | Laser utrustning
- Shenzhen
- Kina
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Läs mer »
- Städutrustning | Tryckeriutrustning och grafisk utrustning
- Taixing
- Kina
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Läs mer »
- Tryckeriutrustning och grafisk utrustning | Övriga maskiner för materialhantering
- Wenzhou
- Kina
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Läs mer »
- Bag gör maskiner | Tryckeriutrustning och grafisk utrustning
- Ruian
- Kina
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Läs mer »
- Bag gör maskiner | Tryckeriutrustning och grafisk utrustning
- Ruian
- Kina
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Läs mer »
- Bag gör maskiner | Tryckeriutrustning och grafisk utrustning
- Ruian
- Kina
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Läs mer »
- Tryckeriutrustning och grafisk utrustning | Papper produkt gör maskiner
- Dongguan
- Kina
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Läs mer »
- Säckar och påsar | Symaskiner | Tryckeriutrustning och grafisk utrustning | Förpackningsmaskiner
- Wenzhou
- Kina
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Läs mer »
- Övriga textilmaskiner | Tryckeriutrustning och grafisk utrustning
- Ahmedabad
- Indien
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Läs mer »
- Bag gör maskiner | Tryckeriutrustning och grafisk utrustning | Förpackningsmaskiner
- Vadodara
- Indien
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Läs mer »
- Maskiner för appretering av textilier | Tryckeriutrustning och grafisk utrustning | Förpackningsmaskiner
- Ahmedabad
- Indien
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Läs mer »
- Tryckeriutrustning och grafisk utrustning | Cement väskor | Elektrisk och elektronisk utrustning
- Ahmedabad
- Indien