תוצאות חיפוש עבור: הדפסה וגרפיקה ציוד
חברות 277 נמצאורישומים הקשורים לבכורה: הדפסה וגרפיקה ציוד
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... קראו עוד »
- שקית ביצוע מכונות | הדפסה וגרפיקה ציוד | מכונות מיון נייר וציוד | הנחת מכונות (layboys), נייר המרה | מכונות ספירת חוץ, נ...
- Hyderabad
- הודו
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... קראו עוד »
- סוכני מוצר אבטחה | הדפסת העברה | שירותי הזרקה, מתכת | חומרי בידוד | אישית מעיינות עיצוב | זיווגים | פייפס | אבזרי צנרת |...
- Amravati
- הודו
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... קראו עוד »
- סוכני מוצר אבטחה | הדפסת העברה | שירותי הזרקה, מתכת | חומרי בידוד | אישית מעיינות עיצוב | זיווגים | פייפס | אבזרי צנרת |...
- Mumbai
- הודו
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... קראו עוד »
- סוכני מוצר אבטחה | הדפסת העברה | שירותי הזרקה, מתכת | חומרי בידוד | אישית מעיינות עיצוב | זיווגים | פייפס | אבזרי צנרת |...
- Faridabad
- הודו
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... קראו עוד »
- מכונות הלבשה אחרות | הדפסה וגרפיקה ציוד | מכונות קרטון ביצוע, מתמשך, גליל | תבניות, גליל, עשיית קרטון | מכונות calenderi...
- Mumbai
- הודו
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... קראו עוד »
- סוכני מוצר אבטחה | הדפסת העברה | שירותי הזרקה, מתכת | חומרי בידוד | אישית מעיינות עיצוב | זיווגים | פייפס | אבזרי צנרת |...
- Bardoli
- הודו
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... קראו עוד »
- סוכני מוצר אבטחה | הדפסת העברה | שירותי הזרקה, מתכת | חומרי בידוד | אישית מעיינות עיצוב | זיווגים | פייפס | אבזרי צנרת |...
- Ahmedabad
- הודו
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... קראו עוד »
- סוכני מוצר אבטחה | הדפסת העברה | שירותי הזרקה, מתכת | חומרי בידוד | אישית מעיינות עיצוב | זיווגים | פייפס | אבזרי צנרת |...
- Pune
- הודו
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... קראו עוד »
- סוכני מוצר אבטחה | הדפסת העברה | שירותי הזרקה, מתכת | חומרי בידוד | אישית מעיינות עיצוב | זיווגים | פייפס | אבזרי צנרת |...
- Kalol
- הודו
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- הדפסה וגרפיקה ציוד | בתי דפוס,,, מהפכה צילינדר יחידה | בתי דפוס, גליל, שתי מהפכה | בתי דפוס, גליל, תחנת צילינדרים | מכונ...
- Wadhwan
- הודו
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... קראו עוד »
- שקיות | מכונות רטובות מהבילים, טקסטיל | מכונות מהבילות יבשות מ, טקסטיל | מהביל מכשירי חשמל, לחץ נמוך, טקסטיל | תיבות מהב...
- New Delhi
- הודו
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... קראו עוד »
- סוכני מוצר אבטחה | הדפסת העברה | שירותי הזרקה, מתכת | חומרי בידוד | אישית מעיינות עיצוב | זיווגים | פייפס | אבזרי צנרת |...
- Ilkal
- הודו
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- יבואנים-יצואנים, נייר | נייר טואלט | מגבונים, ממחטות ורקמות פנים, מוך מתאית | נייר טואלט, moisturised | מגבונים, נייר, ת...
- Jodhpur
- הודו
supplyautonomy.com/laxmiudyog.in
- סוכני מוצר אבטחה | הדפסת העברה | שירותי הזרקה, מתכת | חומרי בידוד | אישית מעיינות עיצוב | זיווגים | פייפס | אבזרי צנרת |...
- Mumbai
- הודו
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... קראו עוד »
- זיווגים | שסתומים כדור | פרפר שסתומים | מסועים, מלט סיבים | מוצרי מלט Fibre, עמיד אש | הדפסה וגרפיקה ציוד | מסבים רגילים...
- Howrah
- הודו
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... קראו עוד »
- הדפסה וגרפיקה ציוד | מכונה לעיבוד נייר | מדפסות וקלסרים
- Ahmedabad
- הודו
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... קראו עוד »
- סרט למתוח | הדפסה וגרפיקה ציוד | מכונה אריזה
- Wenzhou
- סין
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... קראו עוד »
- הדפסה וגרפיקה ציוד | מכונה לעיבוד נייר | מכונה לטחינת מתכת
- Cangzhou
- סין
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... קראו עוד »
- הדפסה וגרפיקה ציוד | מכשור לייזר
- Shenzhen
- סין
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... קראו עוד »
- ניקוי ציוד | הדפסה וגרפיקה ציוד
- Taixing
- סין
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... קראו עוד »
- הדפסה וגרפיקה ציוד | טיפול בציוד חומר אחר
- Wenzhou
- סין
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... קראו עוד »
- שקית ביצוע מכונות | הדפסה וגרפיקה ציוד
- Ruian
- סין
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... קראו עוד »
- שקית ביצוע מכונות | הדפסה וגרפיקה ציוד
- Ruian
- סין
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... קראו עוד »
- שקית ביצוע מכונות | הדפסה וגרפיקה ציוד
- Ruian
- סין
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... קראו עוד »
- הדפסה וגרפיקה ציוד | מוצר נייר ביצוע מכונות
- Dongguan
- סין
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... קראו עוד »
- שקי ושקיות | מכונות תפירה | הדפסה וגרפיקה ציוד | מכונה אריזה
- Wenzhou
- סין
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... קראו עוד »
- מכונה טקסטיל אחר | הדפסה וגרפיקה ציוד
- Ahmedabad
- הודו
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... קראו עוד »
- שקית ביצוע מכונות | הדפסה וגרפיקה ציוד | מכונה אריזה
- Vadodara
- הודו
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... קראו עוד »
- מכונה טקסטיל-גמר | הדפסה וגרפיקה ציוד | מכונה אריזה
- Ahmedabad
- הודו
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... קראו עוד »
- הדפסה וגרפיקה ציוד | שקי מלט | ציוד חשמלי ואלקטרוני
- Ahmedabad
- הודו