Loading...
Search Results for: Drying of chemical products
Found 36 companiesPreferred listings related to: Drying of chemical products
globalcatalog.com/librawpharma.in
Manufacturers and Exporters Of Pharmaceutical Products Like Tablets Including Polyoxyl 40 Hydrogenated Castor Oil, Solvent Enteric Coating Polymer, Lake Colours Aqueous Enteric Coating Polymers,... Read More »
- Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein purification services | Extraction and...
- New Delhi
- India
globalcatalog.com/hrsprocesssystems.in
Manufacturers, Exporters & Importers Of Wide Range Of Heat Exchangers, ECOFLUX* Corrugated Tube Heat Exchanger, Shell And Tube Heat Exchanger, UNICUS® Scraped Surface Heat Exchanger, ... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Pune
- India
globalcatalog.com/sofresidengineering.fr
- Pipework contractors, chemical and nuclear effluent systems | Pipework installation contractors, chemical plant |...
- Montigny-le-Bretonneux
- France
globalcatalog.com/lgobbisrl.it
- Production services, dietary supplements | Regeneration of catalysts | Regeneration services for activated carbon |...
- CAMPO LIGURE (GE)
- Italy
globalcatalog.com/azelisfrance.fr
- Production services, dietary supplements | Chemicals - import-export | Blending of pharmaceuticals | Spray drying of...
- Paris
- France
globalcatalog.com/borgessa.es
- Grouting, plaster based | Production services, dietary supplements | Commodity merchants, raw rubber and latex |...
- Reus
- Spain
globalcatalog.com/ktronfrance.fr
- Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
- Croissy-sur-Celle
- France
globalcatalog.com/aircontrolsa.es
- Cooling plant, turnkey projects | Production services, dietary supplements | Blending of pharmaceuticals | Spray drying...
- San Sebastián
- Spain
globalcatalog.com/developpementbernardplasencia.fr
- Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
- Saint-Priest
- France
globalcatalog.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
- Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
- Rajagiriya
- Sri Lanka
globalcatalog.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Read More »
- Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
- New Delhi
- India
globalcatalog.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Bengaluru
- India
globalcatalog.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Read More »
- Mixing and blending technology engineering consultants | Production services, dietary supplements | Blending of...
- Runcorn
- United Kingdom
globalcatalog.com/corquimiaindustrialsl.es
- Production services, dietary supplements | Importers-exporters, chemicals | Regeneration of catalysts | Regeneration...
- Esplugues de Llobregat
- Spain
globalcatalog.com/irelspolsro.cz
- Production services, dietary supplements | Packaging services for the transportation of chemicals | Blending of...
- Miroslav
- Czech Republic
globalcatalog.com/nopcopapertechnologysl.es
- Production services, dietary supplements | Recovery of oils and fats from effluent and waste water | Blending of...
- Terrassa
- Spain
globalcatalog.com/toshniwalsystemsandinstrumentsprivatelimited.in
Manufacturers, Exporters & Importers Of Oval Gear Meter, Turbine Flow Meter, Vortex Meter, Density Meter, Cone Meter, Clamp On Ultrasonic Meter, Magnetic Inductive Flow Sensor, Flow Computer,... Read More »
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Chennai
- India
globalcatalog.com/foodbiotechengineersipvt.in
Manufacturers And Exporters Of Dairy and Food Processing Machinery and Equipment.
- Spray drying of pharmaceuticals | Drying of chemical products | Spray drying of chemicals | Freeze drying of chemicals...
- Faridabad
- India
globalcatalog.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- New Delhi
- India
globalcatalog.com/przedstswicielstwoallgaiermogensenswieslawstrobinallgaiermogensen.pl
- Spray drying services for the food industry | Industrial equipment hire | Spray drying of pharmaceuticals | Drying of...
- Lodz
- Poland
globalcatalog.com/alchimexsa.ro
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Bucharest
- Romania
globalcatalog.com/lessonia.fr
- Production services, dietary supplements | Recovery and refining of industrial oil | Recovery and regeneration of...
- ST THONAN
- France
globalcatalog.com/vikashydroinc.in
We introduce ourselves as one of the leading manufacturers and exporters of High Low Pressure Hydraulic Hoses and Hose Assemblies as per the requirement of our prestigious clients.
Vikas Hydro... Read More »
- Drying of chemical products | Cleaning equipment | Auto brake assembly | Road drying machines, pedestrian operated |...
- New Delhi
- India
globalcatalog.com/ikpindustrikemiproduktionviaredab.se
- Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
- Hovås
- Sweden
globalcatalog.com/alliancechimiealgeriespa.dz
- Production services, dietary supplements | General brokers, international trade | Transit traders | Importers with...
- Rouiba
- Algeria
globalcatalog.com/cadar.gb
Cadar Ltd offers Filter Nozzles/Strainers in Polypropylene, PVDF, ABS, Stainless Steel, Hastelloy and many other materials: Concrete monolithic filter floors, pipe header & laterals. Plastic,... Read More »
- Spray drying services for the food industry | Drying of chemical products | Water treatment, industrial - systems and...
- Market Harborough
- United Kingdom
globalcatalog.com/sbdormantcotwolimited.gb
Specialist manufacturers of flame retardents and smoke suppressants. Manufacturer of inorganic borates and stannates.
- Drying of chemical products | Metallising chemicals for printed circuit boards (PCBs) | Electronic circuit coolants |...
- Runcorn
- United Kingdom
globalcatalog.com/solidesdivisestechnologiessdtechsa1.fr
- Granulating services for chemical products | Grinding of chemical products | Drying of chemical products | Spray drying...
- Alès
- France
globalcatalog.com/softlogicfinanceplc.lk
We offer a wide range of Financial Solutions for both Corporate and Personal Financial Needs tailor made for their unique requirements. They include:- * Fixed Deposits * Personal Loans * Savings *... Read More »
- Drying of chemical products
- Colombo 2
- Sri Lanka
globalcatalog.com/srichavadipharmapvt.in
Manufacturer & Exporters of Bulk Drugs, Intermidiats and Fine Chemicals. 826-55-1 Alpha Alpha-Dimethyl Phenyl Acetic Acid 115-46-8 Azacyclonal 123-99-9 Azelaic Acid 35486-42-1... Read More »
- Drying of chemical products | Chloro-4-methylphenoxyacetic acid | Mecoprop (CMPP 2,4)
- Hyderabad
- India