Loading...
Kết quả tìm kiếm cho: In ấn và thiết bị đồ họa
Công ty 277 được tìm thấyDanh sách ưa thích liên quan đến: In ấn và thiết bị đồ họa
supplyautonomy.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Đọc thêm »
- Làm túi Máy móc | In ấn và thiết bị đồ họa | Giấy máy móc thiết bị phân loại | Máy đặt (layboys), giấy chuyển đổi | Máy ...
- Hyderabad
- Ấn Độ
supplyautonomy.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Amravati
- Ấn Độ
supplyautonomy.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Mumbai
- Ấn Độ
supplyautonomy.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Faridabad
- Ấn Độ
supplyautonomy.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Đọc thêm »
- Trang phục khác Máy móc | In ấn và thiết bị đồ họa | Bìa cứng làm cho máy móc, liên tục, xi lanh | Khuôn mẫu, xi lanh, l...
- Mumbai
- Ấn Độ
supplyautonomy.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Bardoli
- Ấn Độ
supplyautonomy.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Ahmedabad
- Ấn Độ
supplyautonomy.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Pune
- Ấn Độ
supplyautonomy.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Kalol
- Ấn Độ
supplyautonomy.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- In ấn và thiết bị đồ họa | In ấn, hình trụ, một cuộc cách mạng | In ấn, hình trụ, hai cuộc cách mạng | In ấn, hình trụ, ...
- Wadhwan
- Ấn Độ
supplyautonomy.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Đọc thêm »
- Túi Xách | Máy xông hơi ướt, dệt may | Máy hấp khô, dệt may | Hấp thiết bị, áp suất thấp, dệt may | Hộp hấp, dệt may | B...
- New Delhi
- Ấn Độ
supplyautonomy.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Đọc thêm »
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Ilkal
- Ấn Độ
supplyautonomy.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Nhập khẩu, xuất khẩu, giấy | Giấy vệ sinh | Khăn ăn, khăn tay và khăn giấy lau mặt, tấm lót xenlulo | Giấy vệ sinh, dư...
- Jodhpur
- Ấn Độ
supplyautonomy.com/laxmiudyog.in
- An ninh Đại lý sản phẩm | Chuyển In ấn | Dịch vụ tiêm đúc, kim loại | Vật liệu cách nhiệt | Tùy chỉnh thiết kế lò xo | K...
- Mumbai
- Ấn Độ
supplyautonomy.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Đọc thêm »
- Khớp nối | Van bi | Van bướm | Băng tải, xi măng sợi | Sản phẩm xi măng sợi, chống cháy | In ấn và thiết bị đồ họa | Vòn...
- Howrah
- Ấn Độ
supplyautonomy.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Đọc thêm »
- In ấn và thiết bị đồ họa | Giấy chế biến Máy móc | Máy in và chất kết dính
- Ahmedabad
- Ấn Độ
supplyautonomy.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Đọc thêm »
- Bộ phim kéo dài | In ấn và thiết bị đồ họa | Máy móc bao bì
- Wenzhou
- Trung Quốc
supplyautonomy.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Đọc thêm »
- In ấn và thiết bị đồ họa | Giấy chế biến Máy móc | Máy công cụ gia công kim loại phay
- Cangzhou
- Trung Quốc
supplyautonomy.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Đọc thêm »
- In ấn và thiết bị đồ họa | Thiết bị laser
- Shenzhen
- Trung Quốc
supplyautonomy.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Đọc thêm »
- Thiết bị làm sạch | In ấn và thiết bị đồ họa
- Taixing
- Trung Quốc
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Đọc thêm »
- In ấn và thiết bị đồ họa | Khác Vật liệu Thiết bị
- Wenzhou
- Trung Quốc
supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Đọc thêm »
- Làm túi Máy móc | In ấn và thiết bị đồ họa
- Ruian
- Trung Quốc
supplyautonomy.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Đọc thêm »
- Làm túi Máy móc | In ấn và thiết bị đồ họa
- Ruian
- Trung Quốc
supplyautonomy.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Đọc thêm »
- Làm túi Máy móc | In ấn và thiết bị đồ họa
- Ruian
- Trung Quốc
supplyautonomy.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Đọc thêm »
- In ấn và thiết bị đồ họa | Sản phẩm giấy Máy móc
- Dongguan
- Trung Quốc
supplyautonomy.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Đọc thêm »
- Bao và túi | Máy may công nghiệp | In ấn và thiết bị đồ họa | Máy móc bao bì
- Wenzhou
- Trung Quốc
supplyautonomy.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Đọc thêm »
- Dệt may Máy móc khác | In ấn và thiết bị đồ họa
- Ahmedabad
- Ấn Độ
supplyautonomy.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Đọc thêm »
- Làm túi Máy móc | In ấn và thiết bị đồ họa | Máy móc bao bì
- Vadodara
- Ấn Độ
supplyautonomy.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Đọc thêm »
- Máy móc dệt hoàn thiện | In ấn và thiết bị đồ họa | Máy móc bao bì
- Ahmedabad
- Ấn Độ
supplyautonomy.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Đọc thêm »
- In ấn và thiết bị đồ họa | Xi măng Túi Xách | Thiết bị điện và điện tử
- Ahmedabad
- Ấn Độ