Loading...
Вынікі пошуку для: Абсталяванне для друку і дызайну графічнага
Знойдзеныя 277 кампанііПераважны аб'яў, звязаных з: Абсталяванне для друку і дызайну графічнага
globalcatalog.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... Больш падрабязна »
- Механізм вырабу сумкі | Абсталяванне для друку і дызайну графічнага | Машыны і абсталяванне для сартавання, разбраковки ...
- Hyderabad
- Індыя
globalcatalog.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... Больш падрабязна »
- Агенты па прадуктах бяспекі | Перакладная друк | Паслугі ліццёвага фармавання металаў | Ізаляцыйныя матэрыялы | Спружыны...
- Amravati
- Індыя
globalcatalog.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... Больш падрабязна »
- Агенты па прадуктах бяспекі | Перакладная друк | Паслугі ліццёвага фармавання металаў | Ізаляцыйныя матэрыялы | Спружыны...
- Mumbai
- Індыя
globalcatalog.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... Больш падрабязна »
- Агенты па прадуктах бяспекі | Перакладная друк | Паслугі ліццёвага фармавання металаў | Ізаляцыйныя матэрыялы | Спружыны...
- Faridabad
- Індыя
globalcatalog.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... Больш падрабязна »
- Іншыя швейныя машыны | Абсталяванне для друку і дызайну графічнага | Машыны картоноделательные круглосеточные бесперапын...
- Mumbai
- Індыя
globalcatalog.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... Больш падрабязна »
- Агенты па прадуктах бяспекі | Перакладная друк | Паслугі ліццёвага фармавання металаў | Ізаляцыйныя матэрыялы | Спружыны...
- Bardoli
- Індыя
globalcatalog.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... Больш падрабязна »
- Агенты па прадуктах бяспекі | Перакладная друк | Паслугі ліццёвага фармавання металаў | Ізаляцыйныя матэрыялы | Спружыны...
- Ahmedabad
- Індыя
globalcatalog.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... Больш падрабязна »
- Агенты па прадуктах бяспекі | Перакладная друк | Паслугі ліццёвага фармавання металаў | Ізаляцыйныя матэрыялы | Спружыны...
- Pune
- Індыя
globalcatalog.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... Больш падрабязна »
- Агенты па прадуктах бяспекі | Перакладная друк | Паслугі ліццёвага фармавання металаў | Ізаляцыйныя матэрыялы | Спружыны...
- Kalol
- Індыя
globalcatalog.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- Абсталяванне для друку і дызайну графічнага | Машыны плоскопечатные однооборотные | Машыны плоскопечатные двухоборотным ...
- Wadhwan
- Індыя
globalcatalog.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... Больш падрабязна »
- Сумкі і дарожныя аксэсуары | Машыны для вільготнага прапарвання тэкстылю | Машыны для сухога прапарвання тэкстылю | Апар...
- New Delhi
- Індыя
globalcatalog.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... Больш падрабязна »
- Агенты па прадуктах бяспекі | Перакладная друк | Паслугі ліццёвага фармавання металаў | Ізаляцыйныя матэрыялы | Спружыны...
- Ilkal
- Індыя
globalcatalog.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- Імпарцёры і экспарцёры паперы | Туалетная папера | Пялёнкі, насавыя хусткі і касметычныя сурвэткі з цэлюлознай ваты | Па...
- Jodhpur
- Індыя
globalcatalog.com/laxmiudyog.in
- Агенты па прадуктах бяспекі | Перакладная друк | Паслугі ліццёвага фармавання металаў | Ізаляцыйныя матэрыялы | Спружыны...
- Mumbai
- Індыя
globalcatalog.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... Больш падрабязна »
- Сувязі | Краны з шаравым кранам | Паваротныя замкі | Стужкі канвеерныя фиброцементные | Вырабы фиброцементные вогнеўстой...
- Howrah
- Індыя
globalcatalog.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... Больш падрабязна »
- Абсталяванне для друку і дызайну графічнага | Машына апрацоўкі папяровых прадуктаў | Прынтэры і злучныя...
- Ahmedabad
- Індыя
globalcatalog.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... Больш падрабязна »
- Выцяжныя плёнкі | Абсталяванне для друку і дызайну графічнага | Ўпаковачная абсталяванне...
- Wenzhou
- Кітай
globalcatalog.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... Больш падрабязна »
- Абсталяванне для друку і дызайну графічнага | Машына апрацоўкі папяровых прадуктаў | Станкі для фрэзеравання металу...
- Cangzhou
- Кітай
globalcatalog.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... Больш падрабязна »
- Абсталяванне для друку і дызайну графічнага | Лазернае абсталяванне...
- Shenzhen
- Кітай
globalcatalog.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... Больш падрабязна »
- Абсталяванне для ачысткі | Абсталяванне для друку і дызайну графічнага...
- Taixing
- Кітай
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Больш падрабязна »
- Абсталяванне для друку і дызайну графічнага | Іншае абсталяванне апрацоўкі матэрыялаў...
- Wenzhou
- Кітай
globalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Больш падрабязна »
- Механізм вырабу сумкі | Абсталяванне для друку і дызайну графічнага...
- Ruian
- Кітай
globalcatalog.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... Больш падрабязна »
- Механізм вырабу сумкі | Абсталяванне для друку і дызайну графічнага...
- Ruian
- Кітай
globalcatalog.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... Больш падрабязна »
- Механізм вырабу сумкі | Абсталяванне для друку і дызайну графічнага...
- Ruian
- Кітай
globalcatalog.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... Больш падрабязна »
- Абсталяванне для друку і дызайну графічнага | Машыны для вырабу папяровай прадукцыі...
- Dongguan
- Кітай
globalcatalog.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... Больш падрабязна »
- Мяшкі і пакеты | Швейныя машыны | Абсталяванне для друку і дызайну графічнага | Ўпаковачная абсталяванне...
- Wenzhou
- Кітай
globalcatalog.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... Больш падрабязна »
- Іншыя тэкстыльнае абсталяванне | Абсталяванне для друку і дызайну графічнага...
- Ahmedabad
- Індыя
globalcatalog.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... Больш падрабязна »
- Механізм вырабу сумкі | Абсталяванне для друку і дызайну графічнага | Ўпаковачная абсталяванне...
- Vadodara
- Індыя
globalcatalog.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... Больш падрабязна »
- Машыны для вырабу аздаблення тэкстылю | Абсталяванне для друку і дызайну графічнага | Ўпаковачная абсталяванне...
- Ahmedabad
- Індыя
globalcatalog.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... Больш падрабязна »
- Абсталяванне для друку і дызайну графічнага | Мяшок цэменту | Электрычнае і электроннае абсталяванне...
- Ahmedabad
- Індыя