Search Results for: Manufacture of basic pharmaceutical products and pharmaceutical preparations

Found 91 companies


globalcatalog.com/bioduro.us
BioDuro is a leading, global life sciences research and development organization with locations in San Diego, Beijing, and Shanghai that provide biopharmaceutical clients and partners with... Read More »
  • Spray drying of pharmaceuticals | Contractors to the chemical and pharmaceutical industries | Emulsions, pharmaceutical...
  • San Diego
  • United States
globalcatalog.com/librawpharma.in
Manufacturers and Exporters Of Pharmaceutical Products Like Tablets Including Polyoxyl 40 Hydrogenated Castor Oil, Solvent Enteric Coating Polymer, Lake Colours Aqueous Enteric Coating Polymers,... Read More »
  • Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein purification services | Extraction and...
  • New Delhi
  • India
globalcatalog.com/schwitzbiotech.in
An ISO 9001: 2000 certified company, established in the year 1998, Schwitz Biotech, is engaged in processing and exporting of a wide range of pharmaceutical formulations to our clients that includes... Read More »
  • Production services, dietary supplements | Importers-exporters, pharmaceuticals and medical supplies |...
  • Ahmedabad
  • India
globalcatalog.com/kochmodularprocess.us
Koch Modular Process is a design-build company specializing in the modular construction for chemical mass transfer systems. Whether it is the design and construction of distillation equipment &... Read More »
  • Plant engineering design services | Contractors to the chemical and pharmaceutical industries | Pilot plant, chemical...
  • Paramus
  • United States
globalcatalog.com/anhydrouk.gb
Drying and cooling equipment machinery manufacturers including spray - flash - ring - and fluid bed. Spray chilling plant manufacturers. Suppliers of plant microencapulation. Full test facilities are... Read More »
  • Industrial facilities - design | Powder technology consultants | Spray drying services for the food industry | Spray...
  • Tonbridge
  • United Kingdom
globalcatalog.com/hrsprocesssystems.in
Manufacturers, Exporters & Importers Of Wide Range Of Heat Exchangers, ECOFLUX* Corrugated Tube Heat Exchanger, Shell And Tube Heat Exchanger, UNICUS® Scraped Surface Heat Exchanger, ... Read More »
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Pune
  • India
globalcatalog.com/univar.fr
  • Chemicals - import-export | Protein purification services | Sieving of pastes for the chemical industry | Air...
  • Fontenay-sous-Bois
  • France
globalcatalog.com/sofresidengineering.fr
  • Pipework contractors, chemical and nuclear effluent systems | Pipework installation contractors, chemical plant |...
  • Montigny-le-Bretonneux
  • France
globalcatalog.com/kellyservices.fr
  • Meteorological consultants | Steam power consultants | Geophysics consultants | Hydrogeology consultants | Groundwater...
  • Clichy
  • France
globalcatalog.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Read More »
  • Mixing and blending technology engineering consultants | Production services, dietary supplements | Blending of...
  • Runcorn
  • United Kingdom
globalcatalog.com/pelletspharmalimited.in
Manufacturers & Exporters of Sustained / Modified Release Pellets / Micro Granules - Retardstomized Development And Manufacturing Of SR Pellets/Micro Granules-Retard of Various Active... Read More »
  • Blending of pharmaceuticals | Preparations for nervous system disorders, sedatives, tranquillisers, Chinese medicine |...
  • Hyderabad
  • India
globalcatalog.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Read More »
  • Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
  • New Delhi
  • India
globalcatalog.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Read More »
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Bengaluru
  • India
globalcatalog.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
  • Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
  • Rajagiriya
  • Sri Lanka
globalcatalog.com/developpementbernardplasencia.fr
  • Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
  • Saint-Priest
  • France
globalcatalog.com/aircontrolsa.es
  • Cooling plant, turnkey projects | Production services, dietary supplements | Blending of pharmaceuticals | Spray drying...
  • San Sebastián
  • Spain
globalcatalog.com/borgessa.es
  • Grouting, plaster based | Production services, dietary supplements | Commodity merchants, raw rubber and latex |...
  • Reus
  • Spain
globalcatalog.com/azelisfrance.fr
  • Production services, dietary supplements | Chemicals - import-export | Blending of pharmaceuticals | Spray drying of...
  • Paris
  • France
globalcatalog.com/epiingredients.fr
  • Blending of pharmaceuticals | Blending of paints and pigments for the chemical industry | Ginger oil | Powdered and...
  • Ancenis
  • France
globalcatalog.com/ktronfrance.fr
  • Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
  • Croissy-sur-Celle
  • France
globalcatalog.com/lgobbisrl.it
  • Production services, dietary supplements | Regeneration of catalysts | Regeneration services for activated carbon |...
  • CAMPO LIGURE (GE)
  • Italy
globalcatalog.com/foodbiotechengineersipvt.in
Manufacturers And Exporters Of Dairy and Food Processing Machinery and Equipment.
  • Spray drying of pharmaceuticals | Drying of chemical products | Spray drying of chemicals | Freeze drying of chemicals...
  • Faridabad
  • India
globalcatalog.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • New Delhi
  • India
globalcatalog.com/przedstswicielstwoallgaiermogensenswieslawstrobinallgaiermogensen.pl
  • Spray drying services for the food industry | Industrial equipment hire | Spray drying of pharmaceuticals | Drying of...
  • Lodz
  • Poland
globalcatalog.com/toshniwalsystemsandinstrumentsprivatelimited.in
Manufacturers, Exporters & Importers Of Oval Gear Meter, Turbine Flow Meter, Vortex Meter, Density Meter, Cone Meter, Clamp On Ultrasonic Meter, Magnetic Inductive Flow Sensor, Flow Computer,... Read More »
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Chennai
  • India
globalcatalog.com/ashvarshafinechemicalspvt.in
Manufacturer and Exporters of Pharmaceutical Intermediates and Drugs Like 2-Acetylbenzoic Acid, 2-Amino-5-bromobenzoic, 2-Amino-6-methylbenzoic Acid, 2-Amino-5-bromothiazole,... Read More »
  • Extraction and purification of human hormones | Biopsy capsules | Succinyl glycyrrhetic acid for pharmaceuticals |...
  • Hyderabad
  • India
globalcatalog.com/irelspolsro.cz
  • Production services, dietary supplements | Packaging services for the transportation of chemicals | Blending of...
  • Miroslav
  • Czech Republic
globalcatalog.com/corquimiaindustrialsl.es
  • Production services, dietary supplements | Importers-exporters, chemicals | Regeneration of catalysts | Regeneration...
  • Esplugues de Llobregat
  • Spain