Search Results for: Sieving of pastes for the chemical industry

Found 34 companies


globalcatalog.com/robinsonwirecloth.gb
Robinson Wire Cloth Ltd are a supplier of all types of filter meshes and materials. Our extensive in-house facilities enable us to manufacture woven mesh screens, tension screens and bonded screens... Read More »
  • Sieving of liquids for the chemical industry | Sieving of solids for the chemical industry | Sieving of pastes for the...
  • Stoke On Trent
  • United Kingdom
globalcatalog.com/univar.fr
  • Chemicals - import-export | Protein purification services | Sieving of pastes for the chemical industry | Air...
  • Fontenay-sous-Bois
  • France
globalcatalog.com/sofresidengineering.fr
  • Pipework contractors, chemical and nuclear effluent systems | Pipework installation contractors, chemical plant |...
  • Montigny-le-Bretonneux
  • France
globalcatalog.com/sudarshandhoopp.in
Manufacturers and Exporters of Incense Products like Dhoop, Agarbathi Coils and Cones, Extruded Bambooless Sticks, Incense Sticks, Magical Charcoal Tablets, Pure Natural Agarbatti, Incense Gift Sets... Read More »
  • Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
  • New Delhi
  • India
globalcatalog.com/lgobbisrl.it
  • Production services, dietary supplements | Regeneration of catalysts | Regeneration services for activated carbon |...
  • CAMPO LIGURE (GE)
  • Italy
globalcatalog.com/stridesarcolab.in
Manufacturer, Exporters and Importers of Antibiotics, Cephalophins, Nutracentieah, HIV Rearoviral, Vitamins, Soft Gelatin Capsule, Tablet, Liquid Injection, Dry Powder Injection, Oral Solid Dosage... Read More »
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Bengaluru
  • India
globalcatalog.com/islandwidemarketingservicespvt.lk
Import & Supply of Industrial Chemicals,Machinery Lab Equipment,Packaging along with the Technological Inputs & Clearing & Forwarding Agents,Export of Coconut based... Read More »
  • Recovery and regeneration of volatile organic compounds (VOC) | Protein purification services | Sieving of liquids for...
  • Rajagiriya
  • Sri Lanka
globalcatalog.com/developpementbernardplasencia.fr
  • Pharmaceutical production engineering consultants | Biochemical engineering consultants | Regeneration services for...
  • Saint-Priest
  • France
globalcatalog.com/hosokawamicronlimited.gb
Hosokawa Micron Ltd is your single source for integrated powder processing systems and containment solutions. Our core products and services include particle design for nano technology, size... Read More »
  • Mixing and blending technology engineering consultants | Production services, dietary supplements | Blending of...
  • Runcorn
  • United Kingdom
globalcatalog.com/borgessa.es
  • Grouting, plaster based | Production services, dietary supplements | Commodity merchants, raw rubber and latex |...
  • Reus
  • Spain
globalcatalog.com/azelisfrance.fr
  • Production services, dietary supplements | Chemicals - import-export | Blending of pharmaceuticals | Spray drying of...
  • Paris
  • France
globalcatalog.com/ktronfrance.fr
  • Production services, dietary supplements | Filling and packaging services, solvents and adhesives, industrial |...
  • Croissy-sur-Celle
  • France
globalcatalog.com/aircontrolsa.es
  • Cooling plant, turnkey projects | Production services, dietary supplements | Blending of pharmaceuticals | Spray drying...
  • San Sebastián
  • Spain
globalcatalog.com/ajantachemicals.in
Manufacturers and Exporters of Agro Chemicals, Organic Chemicals and Inorganic Chemicals.
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • New Delhi
  • India
globalcatalog.com/alchimexsa.ro
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Bucharest
  • Romania
globalcatalog.com/toshniwalsystemsandinstrumentsprivatelimited.in
Manufacturers, Exporters & Importers Of Oval Gear Meter, Turbine Flow Meter, Vortex Meter, Density Meter, Cone Meter, Clamp On Ultrasonic Meter, Magnetic Inductive Flow Sensor, Flow Computer,... Read More »
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Chennai
  • India
globalcatalog.com/nopcopapertechnologysl.es
  • Production services, dietary supplements | Recovery of oils and fats from effluent and waste water | Blending of...
  • Terrassa
  • Spain
globalcatalog.com/corquimiaindustrialsl.es
  • Production services, dietary supplements | Importers-exporters, chemicals | Regeneration of catalysts | Regeneration...
  • Esplugues de Llobregat
  • Spain
globalcatalog.com/irelspolsro.cz
  • Production services, dietary supplements | Packaging services for the transportation of chemicals | Blending of...
  • Miroslav
  • Czech Republic
globalcatalog.com/swecoeuropedivisionfrance.fr
  • Sieving of liquids for the chemical industry | Sieving of solids for the chemical industry | Sieving of pastes for the...
  • VALENCIENNES
  • France
globalcatalog.com/coger.fr
  • Sieving of pastes for the chemical industry | Air classification services for the chemical industry | Calcining of...
  • PARIS 15
  • France
globalcatalog.com/lessonia.fr
  • Production services, dietary supplements | Recovery and refining of industrial oil | Recovery and regeneration of...
  • ST THONAN
  • France
globalcatalog.com/ikpindustrikemiproduktionviaredab.se
  • Production services, dietary supplements | Blending of pharmaceuticals | Spray drying of pharmaceuticals | Protein...
  • Hovås
  • Sweden
globalcatalog.com/alliancechimiealgeriespa.dz
  • Production services, dietary supplements | General brokers, international trade | Transit traders | Importers with...
  • Rouiba
  • Algeria
globalcatalog.com/l.pl
  • Sieving of liquids for the chemical industry | Sieving of solids for the chemical industry | Sieving of pastes for the...
  • Bytom
  • Poland
globalcatalog.com/fredrikmogensenab.se
  • Sieving of liquids for the chemical industry | Sieving of solids for the chemical industry | Sieving of pastes for the...
  • Hjo
  • Sweden
globalcatalog.com/jikoshaengineeringcorporation.in
Manufactures and Exporters of Micro Pulverizer, Ball Mill, Impact Pulverizer, Tray Dryer, Fruit Mill, Multi Mill, Ribbon Blender, Stirrer, Reaction Vessel, Screw Conveyor, etc.
  • Sieving of liquids for the chemical industry | Sieving of pastes for the chemical industry | Food industry plant and...
  • Mumbai
  • India
globalcatalog.com/martongeotechnicalserviceslimited.gb
Geotechnical instrumentation suppliers
  • Sieving of liquids for the chemical industry | Sieving of pastes for the chemical industry | Well screens, drilling...
  • Bury
  • United Kingdom