ძებნის შედეგები: ბეჭდვა და გრაფიკული აღჭურვილობა
ნაპოვნია 277 კომპანიებიმოხსნა განცხადების ეხება: ბეჭდვა და გრაფიკული აღჭურვილობა
globalcatalog.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... დაწვრილებით »
- ჩანთა მიღების მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა | ქაღალდის დახარისხება მანქანები და მოწყობილობა | ჩამოყალიბებული...
- Hyderabad
- ინდოეთი
globalcatalog.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... დაწვრილებით »
- უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
- Amravati
- ინდოეთი
globalcatalog.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... დაწვრილებით »
- უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
- Mumbai
- ინდოეთი
globalcatalog.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... დაწვრილებით »
- უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
- Faridabad
- ინდოეთი
globalcatalog.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... დაწვრილებით »
- სხვა ტანსაცმელი მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა | მუყაო საცხობი დანადგარები, უწყვეტი, ცილინდრიანი | Moulds, ცი...
- Mumbai
- ინდოეთი
globalcatalog.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... დაწვრილებით »
- უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
- Bardoli
- ინდოეთი
globalcatalog.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... დაწვრილებით »
- უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
- Ahmedabad
- ინდოეთი
globalcatalog.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... დაწვრილებით »
- უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
- Pune
- ინდოეთი
globalcatalog.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... დაწვრილებით »
- უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
- Kalol
- ინდოეთი
globalcatalog.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- ბეჭდვა და გრაფიკული აღჭურვილობა | ბეჭდვის presses, ცილინდრიანი, ერთ რევოლუციას | ბეჭდვის presses, ცილინდრიანი, ორი რევოლ...
- Wadhwan
- ინდოეთი
globalcatalog.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... დაწვრილებით »
- ჩანთები | სველი steaming მანქანები, ტექსტილის | მშრალი steaming მანქანები, ტექსტილის | Steaming ტექნიკით, დაბალი წნევის,...
- New Delhi
- ინდოეთი
globalcatalog.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... დაწვრილებით »
- უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
- Ilkal
- ინდოეთი
globalcatalog.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- იმპორტიორთა-ექსპორტიორებს, ქაღალდის | ტუალეტის ქაღალდი | საფენების, ცხვირსახოცები და სახის ქსოვილების, ცელულოზის ბამბა |...
- Jodhpur
- ინდოეთი
globalcatalog.com/laxmiudyog.in
- უსაფრთხოების პროდუქტის აგენტები | გადაცემის ბეჭდვა | ინჟექტორი ჩამოსხმა მომსახურება, რკინის | საიზოლაციო მასალები | საბა...
- Mumbai
- ინდოეთი
globalcatalog.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... დაწვრილებით »
- Couplings | ბურთი სარქველებს | პეპელა სარქველები | ლენტები, ბოჭკოვანი ცემენტის | Fibre ცემენტის პროდუქცია, ცეცხლის გამძლ...
- Howrah
- ინდოეთი
globalcatalog.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | ქაღალდის გადამამუშავებელი დანადგარები | პრინტერი და ბაინდერები...
- Ahmedabad
- ინდოეთი
globalcatalog.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... დაწვრილებით »
- Stretch ფილმი | ბეჭდვა და გრაფიკული აღჭურვილობა | შეფუთვის მანქანები...
- Wenzhou
- ჩინეთი
globalcatalog.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | ქაღალდის გადამამუშავებელი დანადგარები | მანქანა ინსტრუმენტები milling რკინის...
- Cangzhou
- ჩინეთი
globalcatalog.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | ლაზერი აღჭურვილობა...
- Shenzhen
- ჩინეთი
globalcatalog.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... დაწვრილებით »
- დასუფთავების აღჭურვილობა | ბეჭდვა და გრაფიკული აღჭურვილობა...
- Taixing
- ჩინეთი
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | სხვა მატერიალური გატარება აღჭურვილობა...
- Wenzhou
- ჩინეთი
globalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... დაწვრილებით »
- ჩანთა მიღების მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა...
- Ruian
- ჩინეთი
globalcatalog.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... დაწვრილებით »
- ჩანთა მიღების მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა...
- Ruian
- ჩინეთი
globalcatalog.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... დაწვრილებით »
- ჩანთა მიღების მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა...
- Ruian
- ჩინეთი
globalcatalog.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | ქაღალდი პროდუქტის მიღების მანქანა...
- Dongguan
- ჩინეთი
globalcatalog.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... დაწვრილებით »
- ტომრები და ჩანთები | საკერავი მანქანები | ბეჭდვა და გრაფიკული აღჭურვილობა | შეფუთვის მანქანები...
- Wenzhou
- ჩინეთი
globalcatalog.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... დაწვრილებით »
- სხვა ტექსტილის მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა...
- Ahmedabad
- ინდოეთი
globalcatalog.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... დაწვრილებით »
- ჩანთა მიღების მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა | შეფუთვის მანქანები...
- Vadodara
- ინდოეთი
globalcatalog.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... დაწვრილებით »
- ტექსტილი-დასრულების მანქანა | ბეჭდვა და გრაფიკული აღჭურვილობა | შეფუთვის მანქანები...
- Ahmedabad
- ინდოეთი
globalcatalog.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... დაწვრილებით »
- ბეჭდვა და გრაფიკული აღჭურვილობა | ცემენტი ჩანთები | ელექტრო და ელექტრონული მოწყობილობები...
- Ahmedabad
- ინდოეთი