کے لئے تلاش کے نتائج: چھپائی اور گرافیکس کا سامان
ملا 277 کمپنیوںسے متعلق پسندیدہ لسٹنگ: چھپائی اور گرافیکس کا سامان
globalcatalog.com/seniorprintpackmachineryco.in
Manufacturers & Exporters Of Corrugated Board, Box Making Machinery, Corrugated Board Making Plant, Die Punching, Cutting, Creasing & Embossing Machine, Hot Foil Stamping Die Cutting... مزید پڑھیں »
- بیگ بنانے والی مشینری | چھپائی اور گرافیکس کا سامان | کاغذ چھنٹائی کی مشینری اور سامان | بچھانے مشینیں (layboys)، کاغذ ت...
- Hyderabad
- بھارت
globalcatalog.com/cooltechenterprises.in
A renowned name in the domain of Cooling Pads, ABS Ductable Cooling Machine, Desert/Room Coolers, etc., Cool Tech Enterprises has been offering quality to the clients. Combining technology and wide... مزید پڑھیں »
- سیکورٹی کی مصنوعات کے ایجنٹوں | منتقلی پرنٹنگ | انجکشن کی سانچہ سازی کی خدمات، دھات | موصلیت کا مواد | اپنی مرضی کے ڈیزا...
- Amravati
- بھارت
globalcatalog.com/chamundaindustries.in
We are pleased to introduce ourselves as one of the leading Exporters, Manufacturers , Stockists Supplier of stainless steel item,ferrous non-ferrous metal which are required by your company in... مزید پڑھیں »
- سیکورٹی کی مصنوعات کے ایجنٹوں | منتقلی پرنٹنگ | انجکشن کی سانچہ سازی کی خدمات، دھات | موصلیت کا مواد | اپنی مرضی کے ڈیزا...
- Mumbai
- بھارت
globalcatalog.com/hardikenterprises.in
We, Hardik Enterprises, are a customer oriented company involved in the manufacturing & supplying of premium quality industrial fittings. We started our journey in the year 2012, with an... مزید پڑھیں »
- سیکورٹی کی مصنوعات کے ایجنٹوں | منتقلی پرنٹنگ | انجکشن کی سانچہ سازی کی خدمات، دھات | موصلیت کا مواد | اپنی مرضی کے ڈیزا...
- Faridabad
- بھارت
globalcatalog.com/acmemachinerycompany.in
ACME machinery company was established in 1961,
started catering mainly to varied Printing Press and later to Packaging Industry as well, around India. The company built its reputation through... مزید پڑھیں »
- دیگر ملبوسات مشینری | چھپائی اور گرافیکس کا سامان | گتے بنانے کے مشینیں، مسلسل، سلنڈر | Moulds، سلنڈر، گتے سازی | Calend...
- Mumbai
- بھارت
globalcatalog.com/ashokenterprise.in
Ashok Enterprise is a reliable firm, known as a trustworthy Trader and Supplier of Garden & Farm Equipment, Engine & Pumpset, Pumps, Generators and Electrical & Control Panels. Our... مزید پڑھیں »
- سیکورٹی کی مصنوعات کے ایجنٹوں | منتقلی پرنٹنگ | انجکشن کی سانچہ سازی کی خدمات، دھات | موصلیت کا مواد | اپنی مرضی کے ڈیزا...
- Bardoli
- بھارت
globalcatalog.com/graphicarbproducts.in
Empowered by experienced professionals who possess sound knowledge of the latest technology, Graphicarb Products has been functioning since 1990. Our company is acknowledged as the leading... مزید پڑھیں »
- سیکورٹی کی مصنوعات کے ایجنٹوں | منتقلی پرنٹنگ | انجکشن کی سانچہ سازی کی خدمات، دھات | موصلیت کا مواد | اپنی مرضی کے ڈیزا...
- Ahmedabad
- بھارت
globalcatalog.com/jitamitraelectroenggpvt.in
An Overview Jitamitra Electro Engg Pvt. Ltd. is a part of ZEN Group, which was established in 1993. Operating from a state-of-the-art infrastructural setup at Ahmednagar (Maharashtra), the company is... مزید پڑھیں »
- سیکورٹی کی مصنوعات کے ایجنٹوں | منتقلی پرنٹنگ | انجکشن کی سانچہ سازی کی خدمات، دھات | موصلیت کا مواد | اپنی مرضی کے ڈیزا...
- Pune
- بھارت
globalcatalog.com/marutienterprise11.in
We, Maruti Enterprise, are working as a prominent Manufacturer and Supplier of Packaging Trays, Food Packaging Trays, Meal Packaging Trays, Blister Forming Packaging, Blister Packaging Tray, Cake... مزید پڑھیں »
- سیکورٹی کی مصنوعات کے ایجنٹوں | منتقلی پرنٹنگ | انجکشن کی سانچہ سازی کی خدمات، دھات | موصلیت کا مواد | اپنی مرضی کے ڈیزا...
- Kalol
- بھارت
globalcatalog.com/akshardhamindustries.in
Manufacturer and Exporters of Multi Colour Gravure Printing Press, Lamination and Slitting Machines.
- چھپائی اور گرافیکس کا سامان | پرنٹنگ پریس، سلنڈر، ایک انقلاب | پرنٹنگ پریس، سلنڈر، دو انقلاب | پرنٹنگ پریس، سلنڈر، سٹاپ-...
- Wadhwan
- بھارت
globalcatalog.com/angelindiacadcampvt.in
Manufacturer, Exporters & Importers of Cutting Plotters, Laser Engravers, Laser Market, CNC Router, Fiber Laser, Laser Welder, Inkjet Printers, Solvent Printer and All kinds of Ink for... مزید پڑھیں »
- بیگ | گیلے steaming مشینیں، ٹیکسٹائل | خشک steaming مشینیں، ٹیکسٹائل | Steaming آلات، کم دباؤ، ٹیکسٹائل | Steaming باکس،...
- New Delhi
- بھارت
globalcatalog.com/gurusalescorporation.in
With extensive industry experience and in-depth knowledge, we, Guru Sales Corporation have established ourselves among the leading suppliers and service providers of high quality Granite Tiles, Solar... مزید پڑھیں »
- سیکورٹی کی مصنوعات کے ایجنٹوں | منتقلی پرنٹنگ | انجکشن کی سانچہ سازی کی خدمات، دھات | موصلیت کا مواد | اپنی مرضی کے ڈیزا...
- Ilkal
- بھارت
globalcatalog.com/gehlotworks.in
Manufacturers and Exporters of Flexo Graphic and Roto-Gravure Printing Machines.
- آئاتکوں-برآمدکنندگان، کاغذ | ٹوالیٹ ٹشو | نیپکن، رومال اور چہرے ٹشو، سیلولوز wadding | ٹوالیٹ ٹشو، moisturised | وائپس، ...
- Jodhpur
- بھارت
globalcatalog.com/laxmiudyog.in
- سیکورٹی کی مصنوعات کے ایجنٹوں | منتقلی پرنٹنگ | انجکشن کی سانچہ سازی کی خدمات، دھات | موصلیت کا مواد | اپنی مرضی کے ڈیزا...
- Mumbai
- بھارت
globalcatalog.com/engineersudyog.in
With extensive technical expertise and a well maintained infrastructure, we, Modern Industries, have carved an eminent position in the competitive market. We are reckoned as a prominent manufacturer,... مزید پڑھیں »
- Couplings کے | گیند والوز | تیتلی والوز | Conveyor بیلٹ، فائبر سیمنٹ | فائبر سیمنٹ مصنوعات، آگ مزاحم | چھپائی اور گرافیک...
- Howrah
- بھارت
globalcatalog.com/lineomaticgraphicindustries.in
Welcome to the world of precision perfection. commitment assurance. innovation excellence. quality and originality.
Line O Matic Graphic Industries has always been a precursor in introducing... مزید پڑھیں »
- چھپائی اور گرافیکس کا سامان | کاغذ پراسیسنگ کی مشینری | پرنٹرز اور binders...
- Ahmedabad
- بھارت
globalcatalog.com/wenzhouduke.cn
Wenzhou Duke Import Export Co., ltd is Located in the Ruian city .We specialized in supplying plastic production machine,auto parts,shopping bags and so on ,especially the brake pads and film... مزید پڑھیں »
- مسلسل فلم | چھپائی اور گرافیکس کا سامان | پیکجنگ مشینری
- Wenzhou
- چین
globalcatalog.com/cangzhoutongbaocartonmachineryco.cn
Our corporation specializes in the development and production of cardboard machinery in Northern China. There are 280 employees in our corporation now and 68 staff members specialize in scientific... مزید پڑھیں »
- چھپائی اور گرافیکس کا سامان | کاغذ پراسیسنگ کی مشینری | گھسائی کرنے والی دھات کے لئے مشینی اوزار...
- Cangzhou
- چین
globalcatalog.com/vicstarmachinerygroup.cn
Shenzhen Vicstar Imp. Exp. Co., Ltd. is specialized in manufacturing of packaging and printing machines, as one of the backbone enterprises in packaging and printing industries in China.
Our... مزید پڑھیں »
- چھپائی اور گرافیکس کا سامان | لیزر کا سامان
- Shenzhen
- چین
globalcatalog.com/taixinglianbangprintingproductsco.cn
PS and CTP Plate is the most comprehensive applied offset plate in the printing industry,China has been developed into a world manufacture plant of offset plate.LianBang Printing Products Co.,Ltd... مزید پڑھیں »
- سامان کی صفائی | چھپائی اور گرافیکس کا سامان
- Taixing
- چین
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... مزید پڑھیں »
- چھپائی اور گرافیکس کا سامان | دوسرے مواد کی ہینڈلنگ کا سامان
- Wenzhou
- چین
globalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... مزید پڑھیں »
- بیگ بنانے والی مشینری | چھپائی اور گرافیکس کا سامان
- Ruian
- چین
globalcatalog.com/ruianlishengprintingpackagingmachineryco.cn
Ruian Lisheng Prining Packing Machinery Factory is an enterprise producing complete sets of plastic soft packing and paper packing equipment. Taking science and technology as support, customer... مزید پڑھیں »
- بیگ بنانے والی مشینری | چھپائی اور گرافیکس کا سامان
- Ruian
- چین
globalcatalog.com/ruianjiangnanmachineryco.cn
As high quality needs of lifr today,beautifully packaged required by everything.Ruian ZHEREN Printing Machine Co,.Ltd.were set up,located in the East China Sea,"Ruian City"
ZHEREN... مزید پڑھیں »
- بیگ بنانے والی مشینری | چھپائی اور گرافیکس کا سامان
- Ruian
- چین
globalcatalog.com/cheungwohingprintingmachineryco.cn
Established in 1995, Cheung Wo Hing Printing Machinery Co., Ltd. (CWH) is a large-scale company based on Hong Kong capital. We concentrate on the RD, manufacturing, and marketing of professional... مزید پڑھیں »
- چھپائی اور گرافیکس کا سامان | کاغذ کی مصنوعات بنانے والی مشینری
- Dongguan
- چین
globalcatalog.com/wenzhouounuopackingmachineryco.cn
Wenzhou Ounuo Machinery Co., Ltd. is a professional manufacturer of fully automatic non-woven bag making machines, Paper cup machine,Non woven Screen printing Machine,Nonwoven printing machines,... مزید پڑھیں »
- بوریاں اور تھیلے | سلائی مشینیں | چھپائی اور گرافیکس کا سامان | پیکجنگ مشینری...
- Wenzhou
- چین
globalcatalog.com/ntexengineeringworkspvt.in
N-TEX Group focuses on productivity, providing flexible solutions wherever resources, performance and interaction requirements permit. By translating a deep understanding of our customers'... مزید پڑھیں »
- دیگر ٹیکسٹائل مشینری | چھپائی اور گرافیکس کا سامان
- Ahmedabad
- بھارت
globalcatalog.com/xlplastics.in
We are pleased to Introduce ourselves and it would not be out of place to say that we are one of the leading manufacturers of Plastic Film converting machinery in the Asian Sub Continent. We have... مزید پڑھیں »
- بیگ بنانے والی مشینری | چھپائی اور گرافیکس کا سامان | پیکجنگ مشینری...
- Vadodara
- بھارت
globalcatalog.com/krishnaengineeringworks6.in
We are pleased to introduce ourselves as one of the leading manufacturers of Plastic Packaging, Paper Converting, Textile Processing Tyre Cord machineries from India. Please visit us at WWW.... مزید پڑھیں »
- ٹیکسٹائل-مکمل کرنے کی مشینری | چھپائی اور گرافیکس کا سامان | پیکجنگ مشینری...
- Ahmedabad
- بھارت
globalcatalog.com/jayomaindustries.in
JAYOMA INDUSTRIES is Manufacturers and Exporter of Textile Screen Both Of Rotary And Flat screen Machinery and Spares. And Also Manufacturing Flexo Plate making Equipments. JAYOMA is Established in... مزید پڑھیں »
- چھپائی اور گرافیکس کا سامان | سیمنٹ بیگ | الیکٹریکل اور الیکٹرانک کا سامان...
- Ahmedabad
- بھارت