نتایج جستجو برای: سرور
شرکت 672 یافتsupplyautonomy.com/worldwideco.eg
Worldwide is an Egyptian Company Specialized in Network Security Solutions.
We supply all Fiber Optic and copper equipments components.
We can supply the clients and the other suppliers with any... ادامه مطلب »
- سرور
- Giza
- مصر
supplyautonomy.com/vietstyle.vn
Vietstyle Informatics Communications is an expert in providing web services and related businesses for a number of customers in Vietnam, Bulgaria, the U.S.A... We are committed to provide our... ادامه مطلب »
- سرور
- Hanoi
- ویتنام
supplyautonomy.com/terraworld.de
We are a Distribution company based in Germany. Our focus is on IT products including: PC, Computer Parts, Desktop, Laptop, Consumer Electronics, Servers and etc. We have recently established a... ادامه مطلب »
- سرور
- Bielefeld
- آلمان
supplyautonomy.com/planexcommunicationsinc.sg
Planex have been the industry leader for the past 10 years. Based in Japan, Planex products are all researched and developed in Japan. Planex networking devices have set it benchmark for their high... ادامه مطلب »
- سرور
- سنگاپور
supplyautonomy.com/areasxsrl.it
We develop and plan new hardware for Industry and IT market; born with SMS Machine a family of hardware gateway to collect and manage SMS
We cooperate wiht Civil Protection in planning new hardware... ادامه مطلب »
- سرور
- Roma
- ایتالیا
supplyautonomy.com/hostmeloncom.in
supplyautonomy.com/cyberinfrastructureplimited.in
Areas Of Expertise:
All Windows, Linux, MAC technologies, Tools, Programming languages including e-commerce, System Programming.
CIS-E-commerce Solutions, We develop the Future
CiS consists of a... ادامه مطلب »
- سرور
- Indore
- هند
supplyautonomy.com/sourcebreakglobaltechnologiespvt.in
SourceBreak Global Technologies Pvt Ltd is an Open Source Solutions company in Bangalore providing professional solutions and support for end to end IT infrastructure in a cost effective manner. We... ادامه مطلب »
- سرور
- Bangalore
- هند
supplyautonomy.com/sapinstallationinangalore.in
We provide SAP IDES installations call: Jeevan : 9611990061
IDES to work with your Laptop or Desktop?
SAP Compatible with Windows VISTA, windows 7 aptops, Intel core i3 I 5 processor also
We... ادامه مطلب »
- سرور
- Bangalore
- هند
supplyautonomy.com/omnanotechpvt.in
We are a subsidiary of a Singapore based MNC OM Associates Pte.Ltd., that is globally renowned in the field of DRAM, Flash, CMOS, Memory Modules. Our Parent is Direct with Micron, USA, the world... ادامه مطلب »
- سرور
- Noida
- هند
supplyautonomy.com/computertroubleshooters.hk
Computer troubleshooters is a global computer support service franchise covering 20 countries. Our technicians are honest, professional full-time businessowners. This ensures that we understand the... ادامه مطلب »
- سرور
- هنگکنگ
supplyautonomy.com/docemobusinesssystems.gb
We are an IT management services company with a successful 10-year history. We specialise in:
Network design and installation
Network management and support
IT project consulting
Rapid,... ادامه مطلب »
- سرور
- Enfield
- بریتانیا
supplyautonomy.com/2jwsolutions.us
We offer Web based Media Management Systems with integrated Streaming Video Server, Analog Video Server, Live Video Encoders, content storage and administration tools.
2JW Solutions LLC is a custom... ادامه مطلب »
- سرور
- Chicago
- ایالات متحدهٔ امریکا
supplyautonomy.com/gecadtechnologiessa.ro
Founded in 2001, Gecad Technologies is part of a well established group of companies (Gecad Group) of 150 IT experts based in Bucharest / Romania, developing software solutions for the international... ادامه مطلب »
- سرور
- Bucharest
- رومانی
supplyautonomy.com/manservecowll.cn
We are professional trading, purchasing and Exporter Company in china, Our team has many years of experience in dealing with foreign trading, and very familiar with legality of different countries.... ادامه مطلب »
- سرور
- Shenzhen
- چین
supplyautonomy.com/suzhoujessoftco.cn
Excel Server is a business-oriented Enterprise Information Platform. It integrates MS Excel and MS SQL Server into a network-based environment, on which an organization's crucial business... ادامه مطلب »
- سرور
- Suzhou
- چین
supplyautonomy.com/netlinksystems.ae
Netlink systems based in Dubai are one of the leading distributors of multimedia products, pabx telephone exchange and networking products.
Estalished in 1998 with head office based in Dubai and... ادامه مطلب »
- سرور
- Dubai
- امارات متحدهٔ عربی
supplyautonomy.com/gearnettechnologies.ae
GEARNET Technologies We strive to attain leadership in the IT industry based on a solid reputation for integrity, coupled with a commitment to excellence and a dedication to 100% client satisfaction... ادامه مطلب »
- سرور
- Dubai
- امارات متحدهٔ عربی
supplyautonomy.com/wafatechnicalsystemsservices.ae
Wafa technical systems services have been in the business of being a leading satellite channel content installers in this region of united arab emirates since 1991, when it was first introduced... ادامه مطلب »
- سرور
- Abu Dhabi
- امارات متحدهٔ عربی
supplyautonomy.com/almanahilcomputerllc.ae
supplyautonomy.com/tvisionsdnbhd.my
T-vision sdn. Bhd. Is a VOIP internet calling company, company with the most experienced communication solution and the persons from different countries worked are with great enthusiasm to serve our... ادامه مطلب »
- سرور
- Kota Kinabalu, Sabah
- مالزی
supplyautonomy.com/smpdcmsdnbhd.my
SMP's data center team is comprised of industry veterans with decades of experience. SMP offered data center solutions range from critical facility infrastructure assessments to turnkey design... ادامه مطلب »
- سرور
- Kuala Lumpur
- مالزی
supplyautonomy.com/gellangarincomputers.ph
AMR System developer for Energy and Water metering system. Our services includes hardware supply, design and customization.
Supplier also of Solar powered Street lights using LED for lower wattage... ادامه مطلب »
- سرور
- Tagum
- فیلیپین
supplyautonomy.com/melbourneit.au
Melbourne IT is a world leader in domain name registrations and related online business solutions. Established in 1996, and listed on the ASX in 1999, the company has experienced rapid growth... ادامه مطلب »
- سرور
- Melbourne
- استرالیا
supplyautonomy.com/yqhongkonginternationalgrouplimited.hk
We are one of the leading computer component distributors in Hong Kong, which specializes in memory modules and hard disk drives. We work with the leading brands HP and IBM to provide a consistent... ادامه مطلب »
- درایوهای هارد دیسک | افزودن بر روی حافظه، کامپیوتر | سرور
- Xianggang
- هنگکنگ
supplyautonomy.com/thomasholdings.us
Thomas Holdings is comprised of several ventures in the mid-Atlantic United States. Core competencies include technology integration, emerging market sales and startup consultation. Thomas Holdings... ادامه مطلب »
- سرور
- Richmond
- ایالات متحدهٔ امریکا
supplyautonomy.com/tophine.cn
ICAMView is an affordable solution to your surveillance and security needs. It is developed based on network technology. Basically, this device allows the user to stream live video images directly... ادامه مطلب »
- سرور
- Shenzhen
- چین
supplyautonomy.com/jjdigitaltechnologies.au
JJ SecuWatch, headquartered in world famous city melbourne, Australia, is an innovative designer of IP surveillance products especially IP / network cameras and video servers. Our goal is to become... ادامه مطلب »
- سرور
- Mulgrave, Mulbourne
- استرالیا
supplyautonomy.com/shinleewoodproductsco.tw
In 1955, shin lee wood products has been founded by lee family. That was first furniture manufacture which doing business with American in southern of Taiwan.
In 1961, the solid wood table has... ادامه مطلب »
- سرور
- Kaohsiung
- تایوان

Loading...