Resultados da pesquisa para: Servidores
Empresas 672 encontradossupplyautonomy.com/worldwideco.eg
Worldwide is an Egyptian Company Specialized in Network Security Solutions.
We supply all Fiber Optic and copper equipments components.
We can supply the clients and the other suppliers with any... Leia mais »
- Servidores
- Giza
- Egito
supplyautonomy.com/vietstyle.vn
Vietstyle Informatics Communications is an expert in providing web services and related businesses for a number of customers in Vietnam, Bulgaria, the U.S.A... We are committed to provide our... Leia mais »
- Servidores
- Hanoi
- Vietnã
supplyautonomy.com/terraworld.de
We are a Distribution company based in Germany. Our focus is on IT products including: PC, Computer Parts, Desktop, Laptop, Consumer Electronics, Servers and etc. We have recently established a... Leia mais »
- Servidores
- Bielefeld
- Alemanha
supplyautonomy.com/planexcommunicationsinc.sg
Planex have been the industry leader for the past 10 years. Based in Japan, Planex products are all researched and developed in Japan. Planex networking devices have set it benchmark for their high... Leia mais »
- Servidores
- Cingapura
supplyautonomy.com/areasxsrl.it
We develop and plan new hardware for Industry and IT market; born with SMS Machine a family of hardware gateway to collect and manage SMS
We cooperate wiht Civil Protection in planning new hardware... Leia mais »
- Servidores
- Roma
- Itália
supplyautonomy.com/hostmeloncom.in
supplyautonomy.com/cyberinfrastructureplimited.in
Areas Of Expertise:
All Windows, Linux, MAC technologies, Tools, Programming languages including e-commerce, System Programming.
CIS-E-commerce Solutions, We develop the Future
CiS consists of a... Leia mais »
- Servidores
- Indore
- Índia
supplyautonomy.com/sourcebreakglobaltechnologiespvt.in
SourceBreak Global Technologies Pvt Ltd is an Open Source Solutions company in Bangalore providing professional solutions and support for end to end IT infrastructure in a cost effective manner. We... Leia mais »
- Servidores
- Bangalore
- Índia
supplyautonomy.com/sapinstallationinangalore.in
We provide SAP IDES installations call: Jeevan : 9611990061
IDES to work with your Laptop or Desktop?
SAP Compatible with Windows VISTA, windows 7 aptops, Intel core i3 I 5 processor also
We... Leia mais »
- Servidores
- Bangalore
- Índia
supplyautonomy.com/omnanotechpvt.in
We are a subsidiary of a Singapore based MNC OM Associates Pte.Ltd., that is globally renowned in the field of DRAM, Flash, CMOS, Memory Modules. Our Parent is Direct with Micron, USA, the world... Leia mais »
- Servidores
- Noida
- Índia
supplyautonomy.com/computertroubleshooters.hk
Computer troubleshooters is a global computer support service franchise covering 20 countries. Our technicians are honest, professional full-time businessowners. This ensures that we understand the... Leia mais »
- Servidores
- Hong Kong
supplyautonomy.com/docemobusinesssystems.gb
We are an IT management services company with a successful 10-year history. We specialise in:
Network design and installation
Network management and support
IT project consulting
Rapid,... Leia mais »
- Servidores
- Enfield
- Reino Unido
supplyautonomy.com/2jwsolutions.us
We offer Web based Media Management Systems with integrated Streaming Video Server, Analog Video Server, Live Video Encoders, content storage and administration tools.
2JW Solutions LLC is a custom... Leia mais »
- Servidores
- Chicago
- Estados Unidos
supplyautonomy.com/gecadtechnologiessa.ro
Founded in 2001, Gecad Technologies is part of a well established group of companies (Gecad Group) of 150 IT experts based in Bucharest / Romania, developing software solutions for the international... Leia mais »
- Servidores
- Bucharest
- Romênia
supplyautonomy.com/manservecowll.cn
We are professional trading, purchasing and Exporter Company in china, Our team has many years of experience in dealing with foreign trading, and very familiar with legality of different countries.... Leia mais »
- Servidores
- Shenzhen
- China
supplyautonomy.com/suzhoujessoftco.cn
Excel Server is a business-oriented Enterprise Information Platform. It integrates MS Excel and MS SQL Server into a network-based environment, on which an organization's crucial business... Leia mais »
- Servidores
- Suzhou
- China
supplyautonomy.com/netlinksystems.ae
Netlink systems based in Dubai are one of the leading distributors of multimedia products, pabx telephone exchange and networking products.
Estalished in 1998 with head office based in Dubai and... Leia mais »
- Servidores
- Dubai
- Emirados Árabes Unidos
supplyautonomy.com/gearnettechnologies.ae
GEARNET Technologies We strive to attain leadership in the IT industry based on a solid reputation for integrity, coupled with a commitment to excellence and a dedication to 100% client satisfaction... Leia mais »
- Servidores
- Dubai
- Emirados Árabes Unidos
supplyautonomy.com/wafatechnicalsystemsservices.ae
Wafa technical systems services have been in the business of being a leading satellite channel content installers in this region of united arab emirates since 1991, when it was first introduced... Leia mais »
- Servidores
- Abu Dhabi
- Emirados Árabes Unidos
supplyautonomy.com/almanahilcomputerllc.ae
supplyautonomy.com/tvisionsdnbhd.my
T-vision sdn. Bhd. Is a VOIP internet calling company, company with the most experienced communication solution and the persons from different countries worked are with great enthusiasm to serve our... Leia mais »
- Servidores
- Kota Kinabalu, Sabah
- Malásia
supplyautonomy.com/smpdcmsdnbhd.my
SMP's data center team is comprised of industry veterans with decades of experience. SMP offered data center solutions range from critical facility infrastructure assessments to turnkey design... Leia mais »
- Servidores
- Kuala Lumpur
- Malásia
supplyautonomy.com/gellangarincomputers.ph
AMR System developer for Energy and Water metering system. Our services includes hardware supply, design and customization.
Supplier also of Solar powered Street lights using LED for lower wattage... Leia mais »
- Servidores
- Tagum
- Filipinas
supplyautonomy.com/melbourneit.au
Melbourne IT is a world leader in domain name registrations and related online business solutions. Established in 1996, and listed on the ASX in 1999, the company has experienced rapid growth... Leia mais »
- Servidores
- Melbourne
- Austrália
supplyautonomy.com/yqhongkonginternationalgrouplimited.hk
We are one of the leading computer component distributors in Hong Kong, which specializes in memory modules and hard disk drives. We work with the leading brands HP and IBM to provide a consistent... Leia mais »
- Discos rígidos | Memória adicional (computadores) | Servidores
- Xianggang
- Hong Kong
supplyautonomy.com/thomasholdings.us
Thomas Holdings is comprised of several ventures in the mid-Atlantic United States. Core competencies include technology integration, emerging market sales and startup consultation. Thomas Holdings... Leia mais »
- Servidores
- Richmond
- Estados Unidos
supplyautonomy.com/tophine.cn
ICAMView is an affordable solution to your surveillance and security needs. It is developed based on network technology. Basically, this device allows the user to stream live video images directly... Leia mais »
- Servidores
- Shenzhen
- China
supplyautonomy.com/jjdigitaltechnologies.au
JJ SecuWatch, headquartered in world famous city melbourne, Australia, is an innovative designer of IP surveillance products especially IP / network cameras and video servers. Our goal is to become... Leia mais »
- Servidores
- Mulgrave, Mulbourne
- Austrália
supplyautonomy.com/shinleewoodproductsco.tw
In 1955, shin lee wood products has been founded by lee family. That was first furniture manufacture which doing business with American in southern of Taiwan.
In 1961, the solid wood table has... Leia mais »
- Servidores
- Kaohsiung
- Taiwan

Loading...