Loading...
Søgeresultater for: Tryk- og grafikudstyr
Gevonden 277 bedrijvenglobalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Lees meer »
- Bag gør maskiner | Tryk- og grafikudstyr
- Ruian
- Kina
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Lees meer »
- Tryk- og grafikudstyr | Andet udstyr til materialehåndtering
- Wenzhou
- Kina
globalcatalog.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine.
The state of art... Lees meer »
- Tryk- og grafikudstyr | Pakkemaskiner
- Mumbai
- Indien
globalcatalog.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... Lees meer »
- Hot prægefolie | Tryk- og grafikudstyr
- Arese
- Italien
globalcatalog.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... Lees meer »
- Bag gør maskiner | Tryk- og grafikudstyr
- Ahmedabad
- Indien
globalcatalog.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... Lees meer »
- Rengøringsudstyr | Tryk- og grafikudstyr | Pakkemaskiner | Hjælpe emballeringsudstyr
- Cangzhou
- Kina
globalcatalog.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... Lees meer »
- Bag gør maskiner | Tryk- og grafikudstyr
- Wenzhou
- Kina
globalcatalog.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... Lees meer »
- Skakte | Telexudstyr | Tryk- og grafikudstyr | Pakkemaskiner
- Ahmedabad
- Indien
globalcatalog.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... Lees meer »
- Aluminiumslegeringer | Tryk- og grafikudstyr | Pakkemaskiner
- Shanghai
- Kina
globalcatalog.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... Lees meer »
- Andet tøj maskiner | Tryk- og grafikudstyr | Pakkemaskiner
- New Delhi
- Indien
globalcatalog.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry.
Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... Lees meer »
- Tryk- og grafikudstyr | Andre brugte maskiner | Tobak og artikler til rygere
- Hamburg
- Tyskland
globalcatalog.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... Lees meer »
- Tryk- og grafikudstyr | Andet udstyr til materialehåndtering | Pakkemaskiner
- New Delhi
- Indien
globalcatalog.com/seniormachineryco.in
About Us
Promoted by a Team of qualified professionals. Highly experienced in the machinery filed.
We are 25 years old, out of which 15 years we were manufacturing Printing related... Lees meer »
- Tryk- og grafikudstyr | Papir forarbejdning maskindele | Pakkemaskiner
- Pune
- Indien
globalcatalog.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
- Grafiske arbejdspladser | Tryk- og grafikudstyr | Blåkopieringsmaskiner | Printere & bindemidler
- Grapevine
- USA
globalcatalog.com/webcoindustries.in
globalcatalog.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative
power and is today one of the leading companies in the area of flexible packaging
Our passion for ... Lees meer »
- Tryk- og grafikudstyr | Rotationsdybtryk maskine
- New Delhi
- Indien
globalcatalog.com/multipresssrl.it
- Prægning, plast - maskiner | Sprøjtning, plast - maskiner | Plast - industrielt maskiner og udstyr | Tryk- og g...
- Ponte San Marco
- Italien
globalcatalog.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... Lees meer »
- Tryk- og grafikudstyr | Trykfarve & maling råmateriale
- Kolkata
- Indien
globalcatalog.com/suntrading.in
globalcatalog.com/kptechmachineindiapvt.in
- Stoffer | Tasker | Tegnebøger | Tryk- og grafikudstyr | Svejseapparater | Non vævet stof
- Ahmedabad
- Indien
globalcatalog.com/hicmachineryco.in
- Elektroniske artikler | Tryk- og grafikudstyr | Pakkemaskiner | Printere & bindemidler
- Amritsar
- Indien
globalcatalog.com/chinacangzhoujiajiamachinerymanufacture.cn
- Værktøj til bygningshåndværkere | Elektrisk og elektronisk udstyr til motorkøretøjer | Tryk- og grafikudstyr | Opspæ...
- Cangzhou
- Kina
globalcatalog.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... Lees meer »
- Tryk- og grafikudstyr
- Amritsar
- Indien
globalcatalog.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... Lees meer »
- Tryk- og grafikudstyr
- Madurai
- Indien
globalcatalog.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... Lees meer »
- Tryk- og grafikudstyr | Tryksager og beslægtede produkter | Trykfarve & maling råmateriale
- Delhi
- Indien
globalcatalog.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... Lees meer »
- Plastic laminering maskiner | Tryk- og grafikudstyr
- Kolkata
- Indien
globalcatalog.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... Lees meer »
- Tryk- og grafikudstyr
- Faridabad
- Indien
globalcatalog.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... Lees meer »
- Tryk- og grafikudstyr
- Gurgaon
- Indien
globalcatalog.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... Lees meer »
- Bag gør maskiner | Tryk- og grafikudstyr
- Ruian
- Kina
globalcatalog.com/marsonsprintgrafmachinespvt.in
- Lim og tape | Tryk- og grafikudstyr | Rotationsdybtryk maskine | Pakkemaskiner | Prægefolie
- Mumbai
- Indien