Search Results for: Percetakan dan peralatan grafis
Perusahaan 277 Ditemukanglobalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Read More »
- Tas membuat mesin | Percetakan dan peralatan grafis
- Ruian
- China
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Read More »
- Percetakan dan peralatan grafis | Peralatan penanganan material lainnya
- Wenzhou
- China
globalcatalog.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine.
The state of art... Read More »
- Percetakan dan peralatan grafis | Mesin kemasan
- Mumbai
- India
globalcatalog.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... Read More »
- Hot stamping foil | Percetakan dan peralatan grafis
- Arese
- Italia
globalcatalog.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... Read More »
- Tas membuat mesin | Percetakan dan peralatan grafis
- Ahmedabad
- India
globalcatalog.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... Read More »
- Membersihkan peralatan | Percetakan dan peralatan grafis | Mesin kemasan | Peralatan kemasan Auxiliary
- Cangzhou
- China
globalcatalog.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... Read More »
- Tas membuat mesin | Percetakan dan peralatan grafis
- Wenzhou
- China
globalcatalog.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... Read More »
- Poros | Peralatan Telex | Percetakan dan peralatan grafis | Mesin kemasan
- Ahmedabad
- India
globalcatalog.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... Read More »
- Paduan Aluminium | Percetakan dan peralatan grafis | Mesin kemasan
- Shanghai
- China
globalcatalog.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... Read More »
- Mesin pakaian lainnya | Percetakan dan peralatan grafis | Mesin kemasan
- New Delhi
- India
globalcatalog.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry.
Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... Read More »
- Percetakan dan peralatan grafis | Mesin yang digunakan Lainnya | Tembakau dan item perokok
- Hamburg
- Jerman
globalcatalog.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... Read More »
- Percetakan dan peralatan grafis | Peralatan penanganan material lainnya | Mesin kemasan
- New Delhi
- India
globalcatalog.com/seniormachineryco.in
About Us
Promoted by a Team of qualified professionals. Highly experienced in the machinery filed.
We are 25 years old, out of which 15 years we were manufacturing Printing related... Read More »
- Percetakan dan peralatan grafis | Kertas bagian pengolahan mesin | Mesin kemasan
- Pune
- India
globalcatalog.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
- Workstation grafis | Percetakan dan peralatan grafis | Mesin Blueprint-menyalin | Printer & pengikat
- Grapevine
- Amerika Serikat
globalcatalog.com/webcoindustries.in
globalcatalog.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative
power and is today one of the leading companies in the area of flexible packaging
Our passion for ... Read More »
- Percetakan dan peralatan grafis | Mesin cetak rotogravure
- New Delhi
- India
globalcatalog.com/multipresssrl.it
- Stamping, plastik - mesin | Injeksi, plastik - mesin | Plastik - mesin industri dan peralatan | Percetakan dan...
- Ponte San Marco
- Italia
globalcatalog.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... Read More »
- Percetakan dan peralatan grafis | Percetakan tinta & bahan baku cat
- Kolkata
- India
globalcatalog.com/suntrading.in
globalcatalog.com/kptechmachineindiapvt.in
- Kain | Tas | Dompet | Percetakan dan peralatan grafis | Peralatan las | Kain non woven
- Ahmedabad
- India
globalcatalog.com/hicmachineryco.in
- Perlengkapan elektronik | Percetakan dan peralatan grafis | Mesin kemasan | Printer & pengikat
- Amritsar
- India
globalcatalog.com/chinacangzhoujiajiamachinerymanufacture.cn
- Alat pembangun ' | Kendaraan peralatan listrik dan elektronik motor | Percetakan dan peralatan grafis | Mandrels dan...
- Cangzhou
- China
globalcatalog.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... Read More »
- Percetakan dan peralatan grafis
- Amritsar
- India
globalcatalog.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... Read More »
- Percetakan dan peralatan grafis
- Madurai
- India
globalcatalog.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... Read More »
- Percetakan dan peralatan grafis | Cetakan dan produk terkait | Percetakan tinta & bahan baku cat
- Delhi
- India
globalcatalog.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... Read More »
- Mesin laminating plastik | Percetakan dan peralatan grafis
- Kolkata
- India
globalcatalog.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... Read More »
- Percetakan dan peralatan grafis
- Faridabad
- India
globalcatalog.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... Read More »
- Percetakan dan peralatan grafis
- Gurgaon
- India
globalcatalog.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... Read More »
- Tas membuat mesin | Percetakan dan peralatan grafis
- Ruian
- China
globalcatalog.com/marsonsprintgrafmachinespvt.in
- Perekat dan tape | Percetakan dan peralatan grafis | Mesin cetak rotogravure | Mesin kemasan | Stamping foil
- Mumbai
- India