Search Results for: Printime dhe grafika pajisjet

Kompanitë e gjetura 277


globalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Lexo më shumë »
  • Qese bërë makineri | Printime dhe grafika pajisjet
  • Ruian
  • Kinë
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Lexo më shumë »
  • Printime dhe grafika pajisjet | Tjetër trajtimit të materialit
  • Wenzhou
  • Kinë
globalcatalog.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine. The state of art... Lexo më shumë »
  • Printime dhe grafika pajisjet | Paketimi makineri
  • Mumbai
  • Indi
globalcatalog.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... Lexo më shumë »
  • Hot vulosje petë | Printime dhe grafika pajisjet
  • Arese
  • Itali
globalcatalog.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... Lexo më shumë »
  • Qese bërë makineri | Printime dhe grafika pajisjet
  • Ahmedabad
  • Indi
globalcatalog.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... Lexo më shumë »
  • Pastrimin e pajisjeve | Printime dhe grafika pajisjet | Paketimi makineri | Pajisjet ndihmëse paketimit
  • Cangzhou
  • Kinë
globalcatalog.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... Lexo më shumë »
  • Qese bërë makineri | Printime dhe grafika pajisjet
  • Wenzhou
  • Kinë
globalcatalog.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... Lexo më shumë »
  • Boshte | Pajisje Telex | Printime dhe grafika pajisjet | Paketimi makineri
  • Ahmedabad
  • Indi
globalcatalog.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... Lexo më shumë »
  • Lidhjeve Alumini | Printime dhe grafika pajisjet | Paketimi makineri
  • Shanghai
  • Kinë
globalcatalog.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... Lexo më shumë »
  • Makineri të tjera veshje | Printime dhe grafika pajisjet | Paketimi makineri
  • New Delhi
  • Indi
globalcatalog.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry. Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... Lexo më shumë »
  • Printime dhe grafika pajisjet | Makineri të tjera të përdorura | Duhani dhe duhanpirësve artikuj
  • Hamburg
  • Gjermani
globalcatalog.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... Lexo më shumë »
  • Printime dhe grafika pajisjet | Tjetër trajtimit të materialit | Paketimi makineri
  • New Delhi
  • Indi
globalcatalog.com/seniormachineryco.in
About Us Promoted by a Team of qualified professionals. Highly experienced in the machinery filed. We are 25 years old, out of which 15 years we were manufacturing Printing related... Lexo më shumë »
  • Printime dhe grafika pajisjet | Përpunimin e pjesëve letër makineri | Paketimi makineri
  • Pune
  • Indi
globalcatalog.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
  • Grafika workstations | Printime dhe grafika pajisjet | Propozimit-kopjim makineri | Printera dhe lidhësit
  • Grapevine
  • Shtetet e Bashkuara të Amerikës
globalcatalog.com/webcoindustries.in
  • Printime dhe grafika pajisjet | Kompensuar printer
  • Faridabad
  • Indi
globalcatalog.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative power and is today one of the leading companies in the area of flexible packaging Our passion for ... Lexo më shumë »
  • Printime dhe grafika pajisjet | Makinë rotogravure shtypjen
  • New Delhi
  • Indi
globalcatalog.com/multipresssrl.it
  • Vulosje, plastike - Makineri | Injeksion, plastike - Makineri | Plastics - Makineri industriale dhe pajisje | Printime...
  • Ponte San Marco
  • Itali
globalcatalog.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... Lexo më shumë »
  • Printime dhe grafika pajisjet | Bojë bojë Printime dhe materiale të papërpunuara
  • Kolkata
  • Indi
globalcatalog.com/suntrading.in
  • Çanta | Kuleta | Printime dhe grafika pajisjet | Kompensuar printer | Pëlhurë jo të endura
  • Chennai
  • Indi
globalcatalog.com/kptechmachineindiapvt.in
  • Pëlhura | Çanta | Kuleta | Printime dhe grafika pajisjet | Saldim Pajisjet | Pëlhurë jo të endura
  • Ahmedabad
  • Indi
globalcatalog.com/hicmachineryco.in
  • Furnizimet elektronike | Printime dhe grafika pajisjet | Paketimi makineri | Printera dhe lidhësit
  • Amritsar
  • Indi
globalcatalog.com/chinacangzhoujiajiamachinerymanufacture.cn
  • Mjete Ndërtuesit ' | Pajisjet motorike automjeteve elektrike dhe elektronike | Printime dhe grafika pajisjet | Mandrels ...
  • Cangzhou
  • Kinë
globalcatalog.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... Lexo më shumë »
  • Printime dhe grafika pajisjet
  • Amritsar
  • Indi
globalcatalog.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... Lexo më shumë »
  • Printime dhe grafika pajisjet
  • Madurai
  • Indi
globalcatalog.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... Lexo më shumë »
  • Printime dhe grafika pajisjet | Çështje të shtypura dhe të produkteve të përafërta | Bojë bojë Printime dhe materiale të...
  • Delhi
  • Indi
globalcatalog.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... Lexo më shumë »
  • Makineri plastike laminating | Printime dhe grafika pajisjet
  • Kolkata
  • Indi
globalcatalog.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... Lexo më shumë »
  • Printime dhe grafika pajisjet
  • Faridabad
  • Indi
globalcatalog.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... Lexo më shumë »
  • Printime dhe grafika pajisjet
  • Gurgaon
  • Indi
globalcatalog.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... Lexo më shumë »
  • Qese bërë makineri | Printime dhe grafika pajisjet
  • Ruian
  • Kinë
globalcatalog.com/marsonsprintgrafmachinespvt.in
  • Ngjitëse dhe kasetë | Printime dhe grafika pajisjet | Makinë rotogravure shtypjen | Paketimi makineri | Fletë vul...
  • Mumbai
  • Indi