के लिए खोज परिणाम: मुद्रण और ग्राफिक्स उपकरण

मिली 277 कंपनियां


globalcatalog.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... और पढ़ें »
  • थैला मशीनरी बनाने | मुद्रण और ग्राफिक्स उपकरण
  • Ruian
  • चीन
globalcatalog.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण | अन्य सामग्री हैंडलिंग उपकरण...
  • Wenzhou
  • चीन
globalcatalog.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine. The state of art... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण | पैकेजिंग मशीनरी
  • Mumbai
  • भारत
globalcatalog.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... और पढ़ें »
  • गर्म मुद्रांकन पन्नी | मुद्रण और ग्राफिक्स उपकरण...
  • Arese
  • इटली
globalcatalog.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... और पढ़ें »
  • थैला मशीनरी बनाने | मुद्रण और ग्राफिक्स उपकरण
  • Ahmedabad
  • भारत
globalcatalog.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... और पढ़ें »
  • उपकरण सफाई | मुद्रण और ग्राफिक्स उपकरण | पैकेजिंग मशीनरी | सहायक उपकरणों की पैकेजिंग...
  • Cangzhou
  • चीन
globalcatalog.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... और पढ़ें »
  • थैला मशीनरी बनाने | मुद्रण और ग्राफिक्स उपकरण
  • Wenzhou
  • चीन
globalcatalog.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... और पढ़ें »
  • शाफ्ट | टेलेक्स उपकरण | मुद्रण और ग्राफिक्स उपकरण | पैकेजिंग मशीनरी...
  • Ahmedabad
  • भारत
globalcatalog.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... और पढ़ें »
  • एल्यूमीनियम मिश्र | मुद्रण और ग्राफिक्स उपकरण | पैकेजिंग मशीनरी...
  • Shanghai
  • चीन
globalcatalog.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... और पढ़ें »
  • अन्य परिधान मशीनरी | मुद्रण और ग्राफिक्स उपकरण | पैकेजिंग मशीनरी...
  • New Delhi
  • भारत
globalcatalog.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry. Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण | अन्य इस्तेमाल किया मशीनरी | तंबाकू और धूम्रपान करने वालों के आइटम...
  • Hamburg
  • जर्मनी
globalcatalog.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण | अन्य सामग्री हैंडलिंग उपकरण | पैकेजिंग मशीनरी...
  • New Delhi
  • भारत
globalcatalog.com/seniormachineryco.in
About Us Promoted by a Team of qualified professionals. Highly experienced in the machinery filed. We are 25 years old, out of which 15 years we were manufacturing Printing related... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण | कागज प्रसंस्करण मशीनरी भागों | पैकेजिंग मशीनरी...
  • Pune
  • भारत
globalcatalog.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
  • ग्राफिक्स कार्यस्थानों | मुद्रण और ग्राफिक्स उपकरण | खाका नकल मशीनरी | प्रिंटर और बाँधने...
  • Grapevine
  • संयुक्त राज्य अमेरिका
globalcatalog.com/webcoindustries.in
  • मुद्रण और ग्राफिक्स उपकरण | प्रिंटर ऑफसेट
  • Faridabad
  • भारत
globalcatalog.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative power and is today one of the leading companies in the area of flexible packaging Our passion for ... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण | रोटार फोटो छपाई मशीन...
  • New Delhi
  • भारत
globalcatalog.com/multipresssrl.it
  • मुद्रांकन, प्लास्टिक - मशीनरी | इंजेक्शन, प्लास्टिक - मशीनरी | प्लास्टिक - औद्योगिक मशीनरी और उपकरण | मुद्रण और ग्राफिक्...
  • Ponte San Marco
  • इटली
globalcatalog.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण | प्रिंटिंग स्याही और पेंट कच्चे माल...
  • Kolkata
  • भारत
globalcatalog.com/suntrading.in
  • बैग | जेब | मुद्रण और ग्राफिक्स उपकरण | प्रिंटर ऑफसेट | गैर बुना कपड़े...
  • Chennai
  • भारत
globalcatalog.com/kptechmachineindiapvt.in
  • कपड़े | बैग | जेब | मुद्रण और ग्राफिक्स उपकरण | वेल्डिंग उपकरण | गैर बुना कपड़े...
  • Ahmedabad
  • भारत
globalcatalog.com/hicmachineryco.in
  • इलेक्ट्रॉनिक आपूर्ति | मुद्रण और ग्राफिक्स उपकरण | पैकेजिंग मशीनरी | प्रिंटर और बाँधने...
  • Amritsar
  • भारत
globalcatalog.com/chinacangzhoujiajiamachinerymanufacture.cn
  • बिल्डर्स 'उपकरण | मोटर वाहन बिजली और इलेक्ट्रॉनिक उपकरणों | मुद्रण और ग्राफिक्स उपकरण | Mandrels और tailstocks...
  • Cangzhou
  • चीन
globalcatalog.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण
  • Amritsar
  • भारत
globalcatalog.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण
  • Madurai
  • भारत
globalcatalog.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण | मुद्रित सामग्री और संबंधित उत्पाद | प्रिंटिंग स्याही और पेंट कच्चे माल...
  • Delhi
  • भारत
globalcatalog.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... और पढ़ें »
  • प्लास्टिक laminating मशीनरी | मुद्रण और ग्राफिक्स उपकरण...
  • Kolkata
  • भारत
globalcatalog.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण
  • Faridabad
  • भारत
globalcatalog.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... और पढ़ें »
  • मुद्रण और ग्राफिक्स उपकरण
  • Gurgaon
  • भारत
globalcatalog.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... और पढ़ें »
  • थैला मशीनरी बनाने | मुद्रण और ग्राफिक्स उपकरण
  • Ruian
  • चीन
globalcatalog.com/marsonsprintgrafmachinespvt.in
  • चिपकने वाले और टेप | मुद्रण और ग्राफिक्स उपकरण | रोटार फोटो छपाई मशीन | पैकेजिंग मशीनरी | मुद्रांकन foils...
  • Mumbai
  • भारत