Αποτελέσματα αναζήτησης για: Εξοπολισμός εκτύπωσης και γραφικών

Βρέθηκαν οι εταιρείες 277


supplyautonomy.com/ruianwanyuanpackingmachineco.cn
We are a manufacturer of non woven bag-making machines with well-equipped testing equipment and strong technical force. With a wide range, good quality, reasonable prices and stylish designs, our... Διαβάστε περισσότερα »
  • Τσάντα μηχανές παραγωγής | Εξοπολισμός εκτύπωσης και γραφικών
  • Ruian
  • Κίνα
supplyautonomy.com/ruianweiguoprintingpackagingmachineryfactory.cn
Wenzhou Qiangtuo Machinery Co., Ltd. (Ruian Weiguo Machinery Pakage Factory) is a professional manufacturer of printing machines, film-blowing machines, bag-making machines, slitting machines and... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών | Άλλος εξοπλισμός χειρισμού υλικών...
  • Wenzhou
  • Κίνα
supplyautonomy.com/acmemachinerycompanypvt.in
Into Manufacturing of Paper Corrugated Carton Production Line, print finishing machines since last three decades with excellent customer base using range of our machine. The state of art... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών | Μηχανήματα συσκευασίας
  • Mumbai
  • Ινδία
supplyautonomy.com/siadgroupsrl.it
SIAD GROUP srl provides end to end solutions for the new business of printing. We provide services and products including consulting, workflow and finishing printing equipment to match the... Διαβάστε περισσότερα »
  • Θερμοτυπίας | Εξοπολισμός εκτύπωσης και γραφικών
  • Arese
  • Ιταλία
supplyautonomy.com/ishaninternational.in
we leading manufacturer of plastic printing machine and bag making machines viz., Rotogravure Printing Machine, Flexo Printing Machine, Bag making machine, side sealing machine, Slitting... Διαβάστε περισσότερα »
  • Τσάντα μηχανές παραγωγής | Εξοπολισμός εκτύπωσης και γραφικών
  • Ahmedabad
  • Ινδία
supplyautonomy.com/junsheng.cn
Our company is located in Dongguang County, Hebei Province, China. We are specialized in manufacturing all kinds of water base ink printing slotting die-cutting machines and whole sets of carton... Διαβάστε περισσότερα »
  • Καθαρισμός των οργάνων | Εξοπολισμός εκτύπωσης και γραφικών | Μηχανήματα συσκευασίας | Βοηθητικός εξοπλισμός συσκευασίας...
  • Cangzhou
  • Κίνα
supplyautonomy.com/zhejiangtianfengplasticmachineryplant.cn
Zhejiang Tianfeng Plastic Machinery Plant is a global supplier of standard and custom-engineered products and systems. Our products serve the complete range of PP/PE woven bag machine, leno mesh bag... Διαβάστε περισσότερα »
  • Τσάντα μηχανές παραγωγής | Εξοπολισμός εκτύπωσης και γραφικών
  • Wenzhou
  • Κίνα
supplyautonomy.com/vishvaeximpvt.in
Manufacturer and Exporters of Roto Gravure Printing Machine, Flexo Graph Printing Machine, Laminators (Solvent less), Laminators (Base), Extrusion Machines, Small Packaging Machinery, Core Cutting... Διαβάστε περισσότερα »
  • Φρέατα | Εξοπλισμός Telex | Εξοπολισμός εκτύπωσης και γραφικών | Μηχανήματα συσκευασίας...
  • Ahmedabad
  • Ινδία
supplyautonomy.com/shanghaipripackmachineryco.cn
Shanghai Pripack Machinery Co., Ltd. is a company that specializes in providing printing & packaging machinery and production line. Owning experienced employees and cooperating with many... Διαβάστε περισσότερα »
  • Κράματα αλουμινίου | Εξοπολισμός εκτύπωσης και γραφικών | Μηχανήματα συσκευασίας...
  • Shanghai
  • Κίνα
supplyautonomy.com/bajajprintpackmachineriespvt.in
We supply hologram Machinery to produce holograms from hologram master shooting to die-cutting, includes hologram master shooting system (2D / 3D master and Dot-matrix master) , recombination... Διαβάστε περισσότερα »
  • Άλλα μηχανήματα ένδυσης | Εξοπολισμός εκτύπωσης και γραφικών | Μηχανήματα συσκευασίας...
  • New Delhi
  • Ινδία
supplyautonomy.com/mmmauenhandelsgesellschaftmbh.de
MMM established in 1986 are specialists in matches industry. Combination of integrity, high business ethics with sound consulatation, makes us your number one souce in Match Machinery and Material... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών | Άλλα μηχανήματα που χρησιμοποιούνται | Καπνός και είδη καπνιστών...
  • Hamburg
  • Γερμανία
supplyautonomy.com/natrajcorrugatingmachinerycompany.in
India's leading manufacturer and exporter of paper corrugated board and box making machinery since1955,Brand SUPER NATARAJA FORMERLY KNOWN AS NATARAJA. company have the experience of making... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών | Άλλος εξοπλισμός χειρισμού υλικών | Μηχανήματα συσκευασίας...
  • New Delhi
  • Ινδία
supplyautonomy.com/seniormachineryco.in
About Us Promoted by a Team of qualified professionals. Highly experienced in the machinery filed. We are 25 years old, out of which 15 years we were manufacturing Printing related... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών | Βιβλίο Μηχανήματα επεξεργασίας Μέρη | Μηχανήματα συσκευασίας...
  • Pune
  • Ινδία
supplyautonomy.com/alphagraphics737.us
At Alphagraphics 737 Grapevine, TX we have the skills and tools to help brand your company effectively. Call us for printing services, blueprint, car wraps, signs and banners.
  • Σταθμοί επεξεργασίας γραφικών | Εξοπολισμός εκτύπωσης και γραφικών | Αναπαραγωγή σχεδίων - μηχανές | Εκτυπωτές & συνδετι...
  • Grapevine
  • Ηνωμένες Πολιτείες της Αμερικής
supplyautonomy.com/webcoindustries.in
  • Εξοπολισμός εκτύπωσης και γραφικών | Offset εκτυπωτή
  • Faridabad
  • Ινδία
supplyautonomy.com/lapraco.in
For more than 38 years, Lapra Co. has been constantly demonstrating its innovative power and is today one of the leading companies in the area of flexible packaging Our passion for ... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών | Βαθυτυπία ρούχων
  • New Delhi
  • Ινδία
supplyautonomy.com/multipresssrl.it
  • Εκτύπωση (σταμπάρισμα) πλαστικών - μηχανήματα | Έγχυση πλαστικών - μηχανήματα | Πλαστικές ύλες - βιομηχανικά μηχανήματα ...
  • Ponte San Marco
  • Ιταλία
supplyautonomy.com/urstechnologyofindia.in
Breaking new grounds in the domain of printers and allied machines, we, URS Technology Of India, have captured a huge market share. Our products are of high quality and meet the industrial quality... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών | Μελάνι εκτύπωσης και βαφής πρώτων υλών...
  • Kolkata
  • Ινδία
supplyautonomy.com/suntrading.in
  • Τσάντες | Πορτοφόλια | Εξοπολισμός εκτύπωσης και γραφικών | Offset εκτυπωτή | Μη υφασμένα υφάσματα...
  • Chennai
  • Ινδία
supplyautonomy.com/kptechmachineindiapvt.in
  • Υφάσματα | Τσάντες | Πορτοφόλια | Εξοπολισμός εκτύπωσης και γραφικών | Εξοπλισμός συγκόλλησης | Μη υφασμένα υφάσματα...
  • Ahmedabad
  • Ινδία
supplyautonomy.com/hicmachineryco.in
  • Ηλεκτρονικό υλικό | Εξοπολισμός εκτύπωσης και γραφικών | Μηχανήματα συσκευασίας | Εκτυπωτές & συνδετικά...
  • Amritsar
  • Ινδία
supplyautonomy.com/chinacangzhoujiajiamachinerymanufacture.cn
  • Εργαλεία για οικοδομές | Μηχανοκίνητα οχήματα ηλεκτρικού και ηλεκτρονικού εξοπλισμού | Εξοπολισμός εκτύπωσης και γραφικώ...
  • Cangzhou
  • Κίνα
supplyautonomy.com/babrahindustrialcorporation.in
About Babrah Industrial CorporationWe, Babrah Industrial Corporation, are meeting the bulk and urgent orders of our valued clients via our robust production facilities, supported distribution network... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών
  • Amritsar
  • Ινδία
supplyautonomy.com/carmelengineering.in
We are manufacturer, supplier and exporter of flexo printing machinery such as flexographic printing machine and apart from this we also deals into non woven printing machine, lamination machine,... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών
  • Madurai
  • Ινδία
supplyautonomy.com/universalinksvarnishplimited.in
In the field of Inks & Varnish, we 'Universal Inks & Varnish (P) Ltd.' are leading the market since 1981 as a renowned manufacturer, exporter, importer and supplier. Our company has... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών | Έντυπο υλικό και συναφή προϊόντα | Μελάνι εκτύπωσης και βαφής πρώτων υλών...
  • Delhi
  • Ινδία
supplyautonomy.com/ramanindustries.in
In the year of 1971 the company was established and engaged itself as a paper converterand susequently in the year of 1973 it had started Machine manufacturing unit. Now-a-days it has covered area... Διαβάστε περισσότερα »
  • Πλαστικά μηχανήματα πλαστικοποίησης | Εξοπολισμός εκτύπωσης και γραφικών...
  • Kolkata
  • Ινδία
supplyautonomy.com/msenterprises20.in
To offer a comprehensive product line meeting the engineering needs of our clients, M.S. Enterprises was established in the year 1975. We are renowned in the industry as leading Manufacturer,... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών
  • Faridabad
  • Ινδία
supplyautonomy.com/asindustrialconsultingservices.in
Catering a range of integrated technical consultancy services to a varied range of industrial houses for setting up new projects in India or abroad...A.S. Industrial Consulting Services, thereafter... Διαβάστε περισσότερα »
  • Εξοπολισμός εκτύπωσης και γραφικών
  • Gurgaon
  • Ινδία
supplyautonomy.com/ruiancambridgemachinery.cn
Located in RUIAN, the well-known Soft Package City of China, Ruian CAMBRIDGE MACHINE I/E Company pours big energy in package machinery. In 2008, we got the foot in manufacturing of Plastic Film... Διαβάστε περισσότερα »
  • Τσάντα μηχανές παραγωγής | Εξοπολισμός εκτύπωσης και γραφικών
  • Ruian
  • Κίνα
supplyautonomy.com/marsonsprintgrafmachinespvt.in
  • Κόλλες και την ταινία | Εξοπολισμός εκτύπωσης και γραφικών | Βαθυτυπία ρούχων | Μηχανήματα συσκευασίας | Σφράγιση μεμβρά...
  • Mumbai
  • Ινδία